data_2MMO # _entry.id 2MMO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MMO pdb_00002mmo 10.2210/pdb2mmo/pdb RCSB RCSB103797 ? ? BMRB 16147 ? ? WWPDB D_1000103797 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 16147 BMRB . unspecified 2MMN PDB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MMO _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2014-03-16 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Munte, C.' 1 'Kalbitzer, H.' 2 'Schirmer, R.' 3 # _citation.id primary _citation.title 'Solution Structure of Plasmodium falciparum Thioredoxin' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Munte, C.' 1 ? primary 'Kalbitzer, H.' 2 ? primary 'Schirmer, R.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Thioredoxin _entity.formula_weight 11699.276 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Trx # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SVKIVTSQSEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKN GSSVDTLLGANDSALKQLIEKYAA ; _entity_poly.pdbx_seq_one_letter_code_can ;SVKIVTSQSEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKN GSSVDTLLGANDSALKQLIEKYAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 VAL n 1 3 LYS n 1 4 ILE n 1 5 VAL n 1 6 THR n 1 7 SER n 1 8 GLN n 1 9 SER n 1 10 GLU n 1 11 PHE n 1 12 ASP n 1 13 SER n 1 14 ILE n 1 15 ILE n 1 16 SER n 1 17 GLN n 1 18 ASN n 1 19 GLU n 1 20 LEU n 1 21 VAL n 1 22 ILE n 1 23 VAL n 1 24 ASP n 1 25 PHE n 1 26 PHE n 1 27 ALA n 1 28 GLU n 1 29 TRP n 1 30 CYS n 1 31 GLY n 1 32 PRO n 1 33 CYS n 1 34 LYS n 1 35 ARG n 1 36 ILE n 1 37 ALA n 1 38 PRO n 1 39 PHE n 1 40 TYR n 1 41 GLU n 1 42 GLU n 1 43 CYS n 1 44 SER n 1 45 LYS n 1 46 THR n 1 47 TYR n 1 48 THR n 1 49 LYS n 1 50 MET n 1 51 VAL n 1 52 PHE n 1 53 ILE n 1 54 LYS n 1 55 VAL n 1 56 ASP n 1 57 VAL n 1 58 ASP n 1 59 GLU n 1 60 VAL n 1 61 SER n 1 62 GLU n 1 63 VAL n 1 64 THR n 1 65 GLU n 1 66 LYS n 1 67 GLU n 1 68 ASN n 1 69 ILE n 1 70 THR n 1 71 SER n 1 72 MET n 1 73 PRO n 1 74 THR n 1 75 PHE n 1 76 LYS n 1 77 VAL n 1 78 TYR n 1 79 LYS n 1 80 ASN n 1 81 GLY n 1 82 SER n 1 83 SER n 1 84 VAL n 1 85 ASP n 1 86 THR n 1 87 LEU n 1 88 LEU n 1 89 GLY n 1 90 ALA n 1 91 ASN n 1 92 ASP n 1 93 SER n 1 94 ALA n 1 95 LEU n 1 96 LYS n 1 97 GLN n 1 98 LEU n 1 99 ILE n 1 100 GLU n 1 101 LYS n 1 102 TYR n 1 103 ALA n 1 104 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PF14_0545 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 3D7 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 36329 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pQE-30 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THIO_PLAF7 _struct_ref.pdbx_db_accession Q7KQL8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNG SSVDTLLGANDSALKQLIEKYAA ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MMO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7KQL8 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 104 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MMO SER A 1 ? UNP Q7KQL8 ? ? 'expression tag' 1 1 1 2MMO SER A 9 ? UNP Q7KQL8 ALA 9 conflict 9 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-15N HSQC' 1 2 3 '2D 1H-13C HSQC' 1 3 2 '3D HNCA' 1 4 2 '3D HNCO' 1 5 3 '3D HCCH-TOCSY' 1 6 1 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM protein-1, 10 mM potassium chloride-2, 1 mM sodium azide-3, 0.1 mM DSS-4, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' '1 mM [U-100% 13C; U-100% 15N] protein-5, 10 mM potassium chloride-6, 1 mM sodium azide-7, 0.1 mM DSS-8, 93% H2O/7% D2O' 2 '93% H2O/7% D2O' '1 mM [U-100% 13C; U-100% 15N] protein-9, 10 mM potassium chloride-10, 1 mM sodium azide-11, 0.1 mM DSS-12, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker DRX 1 'Bruker DRX' 800 Bruker DRX 2 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2MMO _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MMO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MMO _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Bruker Biospin' collection TopSpin 1 ? 'Bruker Biospin' processing TopSpin 2 ? 'Bruker Biospin' 'data analysis' AUREMOL 3 ? 'Bruker Biospin' 'peak picking' AUREMOL 4 ? 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS 5 ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 6 ? 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 7 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MMO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MMO _struct.title 'Solution Structure of the oxidised Thioredoxin from Plasmodium falciparum' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MMO _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'Plasmodium falciparum, Thioredoxin, ELECTRON TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 7 ? GLN A 17 ? SER A 7 GLN A 17 1 ? 11 HELX_P HELX_P2 2 CYS A 30 ? TYR A 47 ? CYS A 30 TYR A 47 1 ? 18 HELX_P HELX_P3 3 VAL A 60 ? GLU A 67 ? VAL A 60 GLU A 67 1 ? 8 HELX_P HELX_P4 4 ASN A 91 ? ALA A 103 ? ASN A 91 ALA A 103 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 30 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 33 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 30 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 33 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.031 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 1 -1.25 2 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 2 -2.42 3 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 3 -1.68 4 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 4 -2.21 5 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 5 -1.59 6 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 6 -2.44 7 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 7 -2.41 8 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 8 -1.82 9 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 9 -2.39 10 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 10 -1.32 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 3 ? ILE A 4 ? LYS A 3 ILE A 4 A 2 VAL A 51 ? ASP A 56 ? VAL A 51 ASP A 56 A 3 LEU A 20 ? PHE A 26 ? LEU A 20 PHE A 26 A 4 THR A 74 ? LYS A 79 ? THR A 74 LYS A 79 A 5 SER A 83 ? LEU A 88 ? SER A 83 LEU A 88 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 3 ? N LYS A 3 O LYS A 54 ? O LYS A 54 A 2 3 O VAL A 51 ? O VAL A 51 N ILE A 22 ? N ILE A 22 A 3 4 N VAL A 21 ? N VAL A 21 O TYR A 78 ? O TYR A 78 A 4 5 N PHE A 75 ? N PHE A 75 O LEU A 87 ? O LEU A 87 # _atom_sites.entry_id 2MMO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ALA 104 104 104 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-04-15 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 1 ? mM ? 1 'potassium chloride-2' 10 ? mM ? 1 'sodium azide-3' 1 ? mM ? 1 DSS-4 0.1 ? mM ? 1 protein-5 1 ? mM '[U-100% 13C; U-100% 15N]' 2 'potassium chloride-6' 10 ? mM ? 2 'sodium azide-7' 1 ? mM ? 2 DSS-8 0.1 ? mM ? 2 protein-9 1 ? mM '[U-100% 13C; U-100% 15N]' 3 'potassium chloride-10' 10 ? mM ? 3 'sodium azide-11' 1 ? mM ? 3 DSS-12 0.1 ? mM ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A VAL 21 ? ? H A TYR 78 ? ? 1.57 2 1 O A GLU 41 ? ? HG A SER 44 ? ? 1.59 3 2 O A LYS 3 ? ? H A LYS 54 ? ? 1.53 4 2 O A GLU 41 ? ? HG A SER 44 ? ? 1.54 5 4 O A VAL 21 ? ? H A TYR 78 ? ? 1.55 6 4 O A LYS 3 ? ? H A LYS 54 ? ? 1.55 7 5 O A LYS 3 ? ? H A LYS 54 ? ? 1.55 8 5 O A VAL 21 ? ? H A TYR 78 ? ? 1.57 9 6 O A GLU 41 ? ? HG A SER 44 ? ? 1.56 10 6 O A LYS 3 ? ? H A LYS 54 ? ? 1.59 11 7 O A LYS 3 ? ? H A LYS 54 ? ? 1.53 12 7 O A GLU 41 ? ? HG A SER 44 ? ? 1.55 13 8 O A LYS 3 ? ? H A LYS 54 ? ? 1.42 14 8 O A VAL 21 ? ? H A TYR 78 ? ? 1.56 15 8 O A GLU 41 ? ? HG A SER 44 ? ? 1.58 16 9 O A VAL 21 ? ? H A TYR 78 ? ? 1.56 17 9 O A GLU 41 ? ? HG A SER 44 ? ? 1.56 18 10 O A LYS 3 ? ? H A LYS 54 ? ? 1.41 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A TRP 29 ? ? CG A TRP 29 ? ? 1.612 1.498 0.114 0.018 N 2 1 CG A TRP 29 ? ? CD1 A TRP 29 ? ? 1.499 1.363 0.136 0.014 N 3 2 CB A TRP 29 ? ? CG A TRP 29 ? ? 1.609 1.498 0.111 0.018 N 4 2 CG A TRP 29 ? ? CD1 A TRP 29 ? ? 1.496 1.363 0.133 0.014 N 5 3 CB A TRP 29 ? ? CG A TRP 29 ? ? 1.611 1.498 0.113 0.018 N 6 3 CG A TRP 29 ? ? CD1 A TRP 29 ? ? 1.496 1.363 0.133 0.014 N 7 4 CB A TRP 29 ? ? CG A TRP 29 ? ? 1.611 1.498 0.113 0.018 N 8 4 CG A TRP 29 ? ? CD1 A TRP 29 ? ? 1.498 1.363 0.135 0.014 N 9 5 CB A TRP 29 ? ? CG A TRP 29 ? ? 1.609 1.498 0.111 0.018 N 10 5 CG A TRP 29 ? ? CD1 A TRP 29 ? ? 1.496 1.363 0.133 0.014 N 11 6 CB A TRP 29 ? ? CG A TRP 29 ? ? 1.610 1.498 0.112 0.018 N 12 6 CG A TRP 29 ? ? CD1 A TRP 29 ? ? 1.497 1.363 0.134 0.014 N 13 7 CG A TRP 29 ? ? CD1 A TRP 29 ? ? 1.496 1.363 0.133 0.014 N 14 8 CB A TRP 29 ? ? CG A TRP 29 ? ? 1.609 1.498 0.111 0.018 N 15 8 CG A TRP 29 ? ? CD1 A TRP 29 ? ? 1.496 1.363 0.133 0.014 N 16 9 CB A TRP 29 ? ? CG A TRP 29 ? ? 1.611 1.498 0.113 0.018 N 17 9 CG A TRP 29 ? ? CD1 A TRP 29 ? ? 1.498 1.363 0.135 0.014 N 18 10 CB A TRP 29 ? ? CG A TRP 29 ? ? 1.608 1.498 0.110 0.018 N 19 10 CG A TRP 29 ? ? CD1 A TRP 29 ? ? 1.495 1.363 0.132 0.014 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 28 ? ? -53.91 -3.36 2 1 THR A 48 ? ? -54.19 2.35 3 1 ILE A 69 ? ? -52.25 107.76 4 1 VAL A 84 ? ? -150.35 -37.51 5 2 GLU A 28 ? ? -54.44 -2.61 6 2 THR A 48 ? ? -52.10 2.94 7 3 GLU A 28 ? ? -54.44 -2.38 8 3 THR A 48 ? ? -53.84 2.31 9 4 GLU A 28 ? ? -53.90 -3.24 10 4 THR A 48 ? ? -52.82 2.24 11 5 GLU A 28 ? ? -54.77 -2.19 12 5 THR A 48 ? ? -53.02 1.91 13 6 GLU A 28 ? ? -54.42 -2.29 14 6 THR A 48 ? ? -52.75 1.62 15 6 VAL A 84 ? ? -149.86 -37.97 16 7 GLU A 28 ? ? -54.55 -2.80 17 7 THR A 48 ? ? -53.81 1.84 18 7 VAL A 60 ? ? -160.32 95.42 19 8 GLU A 28 ? ? -54.52 -2.48 20 8 THR A 48 ? ? -54.56 1.28 21 9 GLU A 28 ? ? -53.88 -3.35 22 9 THR A 48 ? ? -53.61 1.73 23 9 VAL A 84 ? ? -145.12 -39.18 24 10 GLU A 28 ? ? -54.65 -2.41 25 10 THR A 48 ? ? -53.82 2.34 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ALA 104 ? O ? A ALA 104 O 2 2 Y 1 A ALA 104 ? O ? A ALA 104 O 3 3 Y 1 A ALA 104 ? O ? A ALA 104 O 4 4 Y 1 A ALA 104 ? O ? A ALA 104 O 5 5 Y 1 A ALA 104 ? O ? A ALA 104 O 6 6 Y 1 A ALA 104 ? O ? A ALA 104 O 7 7 Y 1 A ALA 104 ? O ? A ALA 104 O 8 8 Y 1 A ALA 104 ? O ? A ALA 104 O 9 9 Y 1 A ALA 104 ? O ? A ALA 104 O 10 10 Y 1 A ALA 104 ? O ? A ALA 104 O #