data_2MMU # _entry.id 2MMU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MMU RCSB RCSB103803 BMRB 19867 WWPDB D_1000103803 # _pdbx_database_related.db_id 19867 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MMU _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-03-18 _pdbx_database_status.SG_entry N _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Das, N.' 1 'Dai, J.' 2 'Hung, I.' 3 'Rajagopalan, M.' 4 'Zhou, H.' 5 'Cross, T.A.' 6 # _citation.id primary _citation.title 'Structure of CrgA, a cell division structural and regulatory protein from Mycobacterium tuberculosis, in lipid bilayers.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 112 _citation.page_first E119 _citation.page_last E126 _citation.year 2015 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25548160 _citation.pdbx_database_id_DOI 10.1073/pnas.1415908112 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Das, N.' 1 primary 'Dai, J.' 2 primary 'Hung, I.' 3 primary 'Rajagopalan, M.R.' 4 primary 'Zhou, H.X.' 5 primary 'Cross, T.A.' 6 # _cell.entry_id 2MMU _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2MMU _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cell division protein CrgA' _entity.formula_weight 11510.767 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFA FMITGLLLTMRWHLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFA FMITGLLLTMRWHLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 LYS n 1 4 SER n 1 5 LYS n 1 6 VAL n 1 7 ARG n 1 8 LYS n 1 9 LYS n 1 10 ASN n 1 11 ASP n 1 12 PHE n 1 13 THR n 1 14 VAL n 1 15 SER n 1 16 ALA n 1 17 VAL n 1 18 SER n 1 19 ARG n 1 20 THR n 1 21 PRO n 1 22 MET n 1 23 LYS n 1 24 VAL n 1 25 LYS n 1 26 VAL n 1 27 GLY n 1 28 PRO n 1 29 SER n 1 30 SER n 1 31 VAL n 1 32 TRP n 1 33 PHE n 1 34 VAL n 1 35 SER n 1 36 LEU n 1 37 PHE n 1 38 ILE n 1 39 GLY n 1 40 LEU n 1 41 MET n 1 42 LEU n 1 43 ILE n 1 44 GLY n 1 45 LEU n 1 46 ILE n 1 47 TRP n 1 48 LEU n 1 49 MET n 1 50 VAL n 1 51 PHE n 1 52 GLN n 1 53 LEU n 1 54 ALA n 1 55 ALA n 1 56 ILE n 1 57 GLY n 1 58 SER n 1 59 GLN n 1 60 ALA n 1 61 PRO n 1 62 THR n 1 63 ALA n 1 64 LEU n 1 65 ASN n 1 66 TRP n 1 67 MET n 1 68 ALA n 1 69 GLN n 1 70 LEU n 1 71 GLY n 1 72 PRO n 1 73 TRP n 1 74 ASN n 1 75 TYR n 1 76 ALA n 1 77 ILE n 1 78 ALA n 1 79 PHE n 1 80 ALA n 1 81 PHE n 1 82 MET n 1 83 ILE n 1 84 THR n 1 85 GLY n 1 86 LEU n 1 87 LEU n 1 88 LEU n 1 89 THR n 1 90 MET n 1 91 ARG n 1 92 TRP n 1 93 HIS n 1 94 LEU n 1 95 GLU n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n 1 100 HIS n 1 101 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'crgA, MT0014, MTCY10H4.11c, Rv0011c' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain H37Rv _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET29b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CRGA_MYCTU _struct_ref.pdbx_db_accession P67376 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFA FMITGLLLTMRWH ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MMU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 93 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P67376 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 93 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 93 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MMU LEU A 94 ? UNP P67376 ? ? 'EXPRESSION TAG' 94 1 1 2MMU GLU A 95 ? UNP P67376 ? ? 'EXPRESSION TAG' 95 2 1 2MMU HIS A 96 ? UNP P67376 ? ? 'EXPRESSION TAG' 96 3 1 2MMU HIS A 97 ? UNP P67376 ? ? 'EXPRESSION TAG' 97 4 1 2MMU HIS A 98 ? UNP P67376 ? ? 'EXPRESSION TAG' 98 5 1 2MMU HIS A 99 ? UNP P67376 ? ? 'EXPRESSION TAG' 99 6 1 2MMU HIS A 100 ? UNP P67376 ? ? 'EXPRESSION TAG' 100 7 1 2MMU HIS A 101 ? UNP P67376 ? ? 'EXPRESSION TAG' 101 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D PISEMA' 2 2 2 '2D 13C-13C DARR' 2 3 2 '3D NCACX,NCOCX,CAN(CO)CX' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 ? 8.0 ambient atm 289 K 2 ? 8.0 ? ? 289 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;15NH4Cl - 1.0/13C glucose - 2.0 g/L [U-100% 13C; U-100% 15N] CrgA, 200 mg/mL [U-15N]-Leu CrgA, 200 mg/mL [U-15N]-Ala CrgA, 200 mg/mL [U-15N]-Val CrgA, 200 mg/mL [U-15N]-Ile CrgA, 200 mg/mL [U-15N]-Trp CrgA, 200 mg/mL [U-15N]-Tyr CrgA, 200 mg/mL [U-15N]-Met CrgA, 200 mg/mL [U-15N]-Phe CrgA, 200 mg/mL [U-15N]-Thr CrgA, 200 mg/mL [U-15N]-Gly CrgA, 200 mg/mL [U-15N]-Ser CrgA, 200 mg/mL [U-15N]-Arg CrgA, 200 mg/mL [U-15N]-Asn CrgA, No organic solvent used ; 1 'No organic solvent used' ;15NH4Cl - 1.0/13C glucose - 2.0 g/L [U-100% 13C; U-100% 15N] CrgA uniform label, 13C glucose 2.0 g/L [U-100% 13C] CrgA reverse label (TIFSW not labelled), 13C glucose 2.0 g/L [U-100% 13C] CrgA reverse label (ILFYS not labelled), No organic solvent used ; 2 'No organic solvent used' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker Avance 1 'Bruker Avance' 600 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MMU _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 0.69 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MMU _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 3.193 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 1.489 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MMU _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TOPSPIN 2.1 1 'Bruker Biospin' processing TOPSPIN 2.1 2 Goddard 'chemical shift assignment' SPARKY 3.114 3 Goddard 'data analysis' SPARKY 3.114 4 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' X-PLOR_NIH 2.34 5 '(NAMD) Phillips, Braun, Wang, Gumbart, Tajkhorshid, Villa, Chipot, Skeel, Kale and Schulten' refinement NAMD 2.9 6 'Schwieters, Kuszewski, Tjandra and Clore' refinement X-PLOR_NIH ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'The structure of CrgA, a transmembrane protein of M. tuberculosis in lipid bilayer' _exptl.entry_id 2MMU _exptl.method 'SOLID-STATE NMR' _exptl.method_details ? # _struct.entry_id 2MMU _struct.title 'Structure of CrgA, a Cell Division Structural and Regulatory Protein from Mycobacterium tuberculosis, in Lipid Bilayers' _struct.pdbx_descriptor 'Cell division protein CrgA' _struct.pdbx_model_details 'fewest violations, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MMU _struct_keywords.pdbx_keywords 'CELL CYCLE' _struct_keywords.text 'CrgA structure, Membrane protein, Hydrated lipid bilayer, CELL CYCLE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 30 ? GLN A 52 ? SER A 30 GLN A 52 1 ? 23 HELX_P HELX_P2 2 GLY A 71 ? ARG A 91 ? GLY A 71 ARG A 91 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2MMU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 VAL 6 6 ? ? ? A . n A 1 7 ARG 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 LYS 9 9 ? ? ? A . n A 1 10 ASN 10 10 ? ? ? A . n A 1 11 ASP 11 11 ? ? ? A . n A 1 12 PHE 12 12 ? ? ? A . n A 1 13 THR 13 13 ? ? ? A . n A 1 14 VAL 14 14 ? ? ? A . n A 1 15 SER 15 15 ? ? ? A . n A 1 16 ALA 16 16 ? ? ? A . n A 1 17 VAL 17 17 ? ? ? A . n A 1 18 SER 18 18 ? ? ? A . n A 1 19 ARG 19 19 ? ? ? A . n A 1 20 THR 20 20 ? ? ? A . n A 1 21 PRO 21 21 ? ? ? A . n A 1 22 MET 22 22 ? ? ? A . n A 1 23 LYS 23 23 ? ? ? A . n A 1 24 VAL 24 24 ? ? ? A . n A 1 25 LYS 25 25 ? ? ? A . n A 1 26 VAL 26 26 ? ? ? A . n A 1 27 GLY 27 27 ? ? ? A . n A 1 28 PRO 28 28 ? ? ? A . n A 1 29 SER 29 29 ? ? ? A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ALA 54 54 ? ? ? A . n A 1 55 ALA 55 55 ? ? ? A . n A 1 56 ILE 56 56 ? ? ? A . n A 1 57 GLY 57 57 ? ? ? A . n A 1 58 SER 58 58 ? ? ? A . n A 1 59 GLN 59 59 ? ? ? A . n A 1 60 ALA 60 60 ? ? ? A . n A 1 61 PRO 61 61 ? ? ? A . n A 1 62 THR 62 62 ? ? ? A . n A 1 63 ALA 63 63 ? ? ? A . n A 1 64 LEU 64 64 ? ? ? A . n A 1 65 ASN 65 65 ? ? ? A . n A 1 66 TRP 66 66 ? ? ? A . n A 1 67 MET 67 67 ? ? ? A . n A 1 68 ALA 68 68 ? ? ? A . n A 1 69 GLN 69 69 ? ? ? A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 HIS 96 96 ? ? ? A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 HIS 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n A 1 100 HIS 100 100 ? ? ? A . n A 1 101 HIS 101 101 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-12-17 2 'Structure model' 1 1 2014-12-31 3 'Structure model' 1 2 2015-03-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Experimental preparation' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Database references' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MMU _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 56 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total ? _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 39 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 39 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 PHE _pdbx_validate_rmsd_bond.auth_seq_id_1 79 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CD1 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 PHE _pdbx_validate_rmsd_bond.auth_seq_id_2 79 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.477 _pdbx_validate_rmsd_bond.bond_target_value 1.383 _pdbx_validate_rmsd_bond.bond_deviation 0.094 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.015 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A PHE 33 ? ? CG A PHE 33 ? ? CD2 A PHE 33 ? ? 125.59 120.80 4.79 0.70 N 2 1 CB A PHE 33 ? ? CG A PHE 33 ? ? CD1 A PHE 33 ? ? 114.97 120.80 -5.83 0.70 N 3 1 CB A TYR 75 ? ? CG A TYR 75 ? ? CD1 A TYR 75 ? ? 125.55 121.00 4.55 0.60 N 4 1 CB A PHE 81 ? ? CG A PHE 81 ? ? CD2 A PHE 81 ? ? 126.33 120.80 5.53 0.70 N 5 1 CB A PHE 81 ? ? CG A PHE 81 ? ? CD1 A PHE 81 ? ? 116.05 120.80 -4.75 0.70 N 6 1 CA A THR 89 ? ? CB A THR 89 ? ? OG1 A THR 89 ? ? 122.26 109.00 13.26 2.10 N 7 1 CA A THR 89 ? ? CB A THR 89 ? ? CG2 A THR 89 ? ? 102.65 112.40 -9.75 1.40 N 8 1 NE A ARG 91 ? ? CZ A ARG 91 ? ? NH1 A ARG 91 ? ? 123.42 120.30 3.12 0.50 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 94 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -31.53 _pdbx_validate_torsion.psi 144.52 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 75 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.110 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A VAL 6 ? A VAL 6 7 1 Y 1 A ARG 7 ? A ARG 7 8 1 Y 1 A LYS 8 ? A LYS 8 9 1 Y 1 A LYS 9 ? A LYS 9 10 1 Y 1 A ASN 10 ? A ASN 10 11 1 Y 1 A ASP 11 ? A ASP 11 12 1 Y 1 A PHE 12 ? A PHE 12 13 1 Y 1 A THR 13 ? A THR 13 14 1 Y 1 A VAL 14 ? A VAL 14 15 1 Y 1 A SER 15 ? A SER 15 16 1 Y 1 A ALA 16 ? A ALA 16 17 1 Y 1 A VAL 17 ? A VAL 17 18 1 Y 1 A SER 18 ? A SER 18 19 1 Y 1 A ARG 19 ? A ARG 19 20 1 Y 1 A THR 20 ? A THR 20 21 1 Y 1 A PRO 21 ? A PRO 21 22 1 Y 1 A MET 22 ? A MET 22 23 1 Y 1 A LYS 23 ? A LYS 23 24 1 Y 1 A VAL 24 ? A VAL 24 25 1 Y 1 A LYS 25 ? A LYS 25 26 1 Y 1 A VAL 26 ? A VAL 26 27 1 Y 1 A GLY 27 ? A GLY 27 28 1 Y 1 A PRO 28 ? A PRO 28 29 1 Y 1 A SER 29 ? A SER 29 30 1 Y 1 A ALA 54 ? A ALA 54 31 1 Y 1 A ALA 55 ? A ALA 55 32 1 Y 1 A ILE 56 ? A ILE 56 33 1 Y 1 A GLY 57 ? A GLY 57 34 1 Y 1 A SER 58 ? A SER 58 35 1 Y 1 A GLN 59 ? A GLN 59 36 1 Y 1 A ALA 60 ? A ALA 60 37 1 Y 1 A PRO 61 ? A PRO 61 38 1 Y 1 A THR 62 ? A THR 62 39 1 Y 1 A ALA 63 ? A ALA 63 40 1 Y 1 A LEU 64 ? A LEU 64 41 1 Y 1 A ASN 65 ? A ASN 65 42 1 Y 1 A TRP 66 ? A TRP 66 43 1 Y 1 A MET 67 ? A MET 67 44 1 Y 1 A ALA 68 ? A ALA 68 45 1 Y 1 A GLN 69 ? A GLN 69 46 1 Y 1 A HIS 96 ? A HIS 96 47 1 Y 1 A HIS 97 ? A HIS 97 48 1 Y 1 A HIS 98 ? A HIS 98 49 1 Y 1 A HIS 99 ? A HIS 99 50 1 Y 1 A HIS 100 ? A HIS 100 51 1 Y 1 A HIS 101 ? A HIS 101 #