data_2MPB # _entry.id 2MPB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MPB pdb_00002mpb 10.2210/pdb2mpb/pdb RCSB RCSB103888 ? ? BMRB 19974 ? ? WWPDB D_1000103888 ? ? # _pdbx_database_related.db_id 19974 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MPB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-05-14 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cicero, D.' 1 'Aran, M.' 2 'Smal, C.' 3 'Pellizza, L.' 4 'Gallo, M.' 5 # _citation.id primary _citation.title ;Solution and crystal structure of BA42, a protein from the Antarctic bacterium Bizionia argentinensis comprised of a stand-alone TPM domain. ; _citation.journal_abbrev Proteins _citation.journal_volume 82 _citation.page_first 3062 _citation.page_last 3078 _citation.year 2014 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25116514 _citation.pdbx_database_id_DOI 10.1002/prot.24667 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aran, M.' 1 ? primary 'Smal, C.' 2 ? primary 'Pellizza, L.' 3 ? primary 'Gallo, M.' 4 ? primary 'Otero, L.H.' 5 ? primary 'Klinke, S.' 6 ? primary 'Goldbaum, F.A.' 7 ? primary 'Ithurralde, E.R.' 8 ? primary 'Bercovich, A.' 9 ? primary 'Mac Cormack, W.P.' 10 ? primary 'Turjanski, A.G.' 11 ? primary 'Cicero, D.O.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description BA42 _entity.formula_weight 16498.586 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSKIEEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYG DKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG ; _entity_poly.pdbx_seq_one_letter_code_can ;MSKIEEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYG DKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LYS n 1 4 ILE n 1 5 GLU n 1 6 GLU n 1 7 PHE n 1 8 LEU n 1 9 THR n 1 10 ALA n 1 11 GLU n 1 12 GLU n 1 13 GLU n 1 14 LYS n 1 15 ALA n 1 16 ILE n 1 17 VAL n 1 18 ASP n 1 19 ALA n 1 20 ILE n 1 21 ARG n 1 22 ASP n 1 23 ALA n 1 24 GLU n 1 25 LYS n 1 26 ASN n 1 27 THR n 1 28 SER n 1 29 GLY n 1 30 GLU n 1 31 ILE n 1 32 ARG n 1 33 VAL n 1 34 HIS n 1 35 LEU n 1 36 GLU n 1 37 LYS n 1 38 THR n 1 39 SER n 1 40 GLU n 1 41 ILE n 1 42 ASP n 1 43 VAL n 1 44 PHE n 1 45 ASP n 1 46 ARG n 1 47 ALA n 1 48 MET n 1 49 ASP n 1 50 VAL n 1 51 PHE n 1 52 HIS n 1 53 ASN n 1 54 LEU n 1 55 LYS n 1 56 MET n 1 57 ASP n 1 58 ASN n 1 59 THR n 1 60 LYS n 1 61 LEU n 1 62 GLN n 1 63 ASN n 1 64 GLY n 1 65 VAL n 1 66 LEU n 1 67 ILE n 1 68 TYR n 1 69 VAL n 1 70 ALA n 1 71 VAL n 1 72 GLU n 1 73 ASP n 1 74 LYS n 1 75 THR n 1 76 PHE n 1 77 VAL n 1 78 ILE n 1 79 TYR n 1 80 GLY n 1 81 ASP n 1 82 LYS n 1 83 GLY n 1 84 ILE n 1 85 ASN n 1 86 ASP n 1 87 VAL n 1 88 VAL n 1 89 SER n 1 90 ASP n 1 91 ASP n 1 92 PHE n 1 93 TRP n 1 94 ASP n 1 95 THR n 1 96 THR n 1 97 ARG n 1 98 ASN n 1 99 ALA n 1 100 ILE n 1 101 GLN n 1 102 LEU n 1 103 GLN n 1 104 PHE n 1 105 LYS n 1 106 GLN n 1 107 GLY n 1 108 ASN n 1 109 PHE n 1 110 LYS n 1 111 GLN n 1 112 GLY n 1 113 LEU n 1 114 VAL n 1 115 ASP n 1 116 GLY n 1 117 ILE n 1 118 GLU n 1 119 LYS n 1 120 ALA n 1 121 GLY n 1 122 MET n 1 123 ALA n 1 124 LEU n 1 125 ALA n 1 126 LYS n 1 127 TYR n 1 128 PHE n 1 129 PRO n 1 130 TRP n 1 131 LYS n 1 132 LYS n 1 133 ASP n 1 134 ASP n 1 135 ILE n 1 136 ASP n 1 137 GLU n 1 138 LEU n 1 139 PRO n 1 140 ASN n 1 141 THR n 1 142 ILE n 1 143 SER n 1 144 LYS n 1 145 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BZARG_1551 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain JUB59 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bizionia argentinensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1046627 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pDEST527 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G2EA45_9FLAO _struct_ref.pdbx_db_accession G2EA45 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSKIEEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYG DKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MPB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 145 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G2EA45 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 145 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 145 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D HNCACB' 1 6 1 '3D HN(CO)CA' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-15N TOCSY' 1 9 1 '3D 1H-13C NOESY aliphatic' 1 10 1 '3D 1H-13C NOESY aromatic' 1 11 1 '2D 1H-13C HSQC aliphatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 301 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '10 mM Tris, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MPB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MPB _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MPB _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 1 'Bruker Biospin' collection TopSpin ? 2 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Putative uncharacterized protein' _exptl.entry_id 2MPB _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MPB _struct.title 'NMR structure of BA42 protein from the psychrophilic bacteria Bizionia argentinensis sp. nov' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MPB _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 9 ? ASP A 22 ? THR A 9 ASP A 22 1 ? 14 HELX_P HELX_P2 2 ASP A 42 ? LEU A 54 ? ASP A 42 LEU A 54 1 ? 13 HELX_P HELX_P3 3 ASP A 81 ? ASP A 86 ? ASP A 81 ASP A 86 1 ? 6 HELX_P HELX_P4 4 SER A 89 ? GLY A 107 ? SER A 89 GLY A 107 1 ? 19 HELX_P HELX_P5 5 ASN A 108 ? PHE A 128 ? ASN A 108 PHE A 128 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 75 ? GLY A 80 ? THR A 75 GLY A 80 A 2 GLY A 64 ? ALA A 70 ? GLY A 64 ALA A 70 A 3 GLU A 30 ? GLU A 36 ? GLU A 30 GLU A 36 A 4 SER A 143 ? LYS A 144 ? SER A 143 LYS A 144 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 77 ? O VAL A 77 N TYR A 68 ? N TYR A 68 A 2 3 O ILE A 67 ? O ILE A 67 N HIS A 34 ? N HIS A 34 A 3 4 N VAL A 33 ? N VAL A 33 O SER A 143 ? O SER A 143 # _atom_sites.entry_id 2MPB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 TRP 130 130 130 TRP TRP A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 GLY 145 145 145 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-08-20 2 'Structure model' 1 1 2014-09-03 3 'Structure model' 1 2 2014-11-05 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_exptl_sample.component Tris-1 _pdbx_nmr_exptl_sample.concentration 10 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 HG A SER 28 ? ? OD1 A ASP 134 ? ? 1.58 2 6 HG A SER 28 ? ? OD1 A ASP 134 ? ? 1.54 3 13 OD1 A ASP 73 ? ? HG1 A THR 75 ? ? 1.57 4 18 HG1 A THR 59 ? ? OE1 A GLU 137 ? ? 1.58 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.48 120.30 3.18 0.50 N 2 1 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.25 120.30 3.95 0.50 N 3 2 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.36 120.30 3.06 0.50 N 4 2 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH2 A ARG 21 ? ? 117.28 120.30 -3.02 0.50 N 5 2 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH1 A ARG 97 ? ? 123.40 120.30 3.10 0.50 N 6 3 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH1 A ARG 97 ? ? 123.99 120.30 3.69 0.50 N 7 4 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH1 A ARG 97 ? ? 124.00 120.30 3.70 0.50 N 8 5 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.57 120.30 4.27 0.50 N 9 6 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.58 120.30 3.28 0.50 N 10 6 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH2 A ARG 21 ? ? 117.28 120.30 -3.02 0.50 N 11 6 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.44 120.30 3.14 0.50 N 12 6 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH1 A ARG 97 ? ? 123.42 120.30 3.12 0.50 N 13 7 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.46 120.30 4.16 0.50 N 14 7 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH1 A ARG 97 ? ? 124.08 120.30 3.78 0.50 N 15 7 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH2 A ARG 97 ? ? 117.06 120.30 -3.24 0.50 N 16 8 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.96 120.30 3.66 0.50 N 17 8 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.00 120.30 3.70 0.50 N 18 8 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH1 A ARG 97 ? ? 124.96 120.30 4.66 0.50 N 19 9 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH1 A ARG 97 ? ? 124.43 120.30 4.13 0.50 N 20 10 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 124.49 120.30 4.19 0.50 N 21 11 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 125.21 120.30 4.91 0.50 N 22 11 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH1 A ARG 97 ? ? 124.73 120.30 4.43 0.50 N 23 12 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.35 120.30 3.05 0.50 N 24 12 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 123.74 120.30 3.44 0.50 N 25 13 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.64 120.30 3.34 0.50 N 26 13 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 123.54 120.30 3.24 0.50 N 27 13 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH1 A ARG 97 ? ? 123.92 120.30 3.62 0.50 N 28 15 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 123.85 120.30 3.55 0.50 N 29 15 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH1 A ARG 97 ? ? 123.54 120.30 3.24 0.50 N 30 16 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.51 120.30 3.21 0.50 N 31 16 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.71 120.30 3.41 0.50 N 32 16 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.61 120.30 4.31 0.50 N 33 16 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH2 A ARG 46 ? ? 115.79 120.30 -4.51 0.50 N 34 17 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.47 120.30 3.17 0.50 N 35 17 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.41 120.30 4.11 0.50 N 36 18 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 124.03 120.30 3.73 0.50 N 37 18 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.96 120.30 3.66 0.50 N 38 19 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.87 120.30 3.57 0.50 N 39 20 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 123.63 120.30 3.33 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 28 ? ? -80.63 39.01 2 1 LYS A 37 ? ? -68.33 -77.15 3 1 ASN A 58 ? ? -74.48 31.08 4 2 LYS A 37 ? ? -78.85 -73.36 5 2 ASN A 108 ? ? -100.90 64.35 6 3 ILE A 4 ? ? -164.87 100.16 7 3 GLU A 5 ? ? -81.71 44.50 8 3 GLU A 6 ? ? 69.32 -6.11 9 3 LYS A 74 ? ? 70.11 33.14 10 3 ASP A 136 ? ? -54.32 102.96 11 4 GLU A 6 ? ? -114.57 79.07 12 4 LYS A 37 ? ? -80.35 -72.51 13 4 ILE A 41 ? ? -100.10 -125.59 14 5 ILE A 41 ? ? -118.01 -164.98 15 5 ASN A 108 ? ? -102.58 59.05 16 5 ASN A 140 ? ? -79.87 31.76 17 6 GLU A 5 ? ? -116.89 59.93 18 6 PHE A 7 ? ? -85.94 -85.05 19 6 LYS A 37 ? ? -74.57 -80.54 20 6 ASN A 63 ? ? -145.66 33.92 21 6 LYS A 74 ? ? 88.42 14.76 22 6 ASN A 108 ? ? -100.99 75.03 23 7 LYS A 37 ? ? -79.83 -70.61 24 7 ILE A 41 ? ? -120.81 -152.64 25 7 ASN A 108 ? ? -101.87 72.59 26 8 SER A 28 ? ? -90.84 49.72 27 8 ILE A 41 ? ? -127.68 -164.97 28 8 ASN A 58 ? ? -74.98 47.21 29 8 PHE A 128 ? ? -114.38 78.18 30 9 SER A 28 ? ? -81.30 38.25 31 9 LYS A 37 ? ? -75.05 -75.88 32 9 ILE A 41 ? ? -128.76 -150.16 33 10 ILE A 41 ? ? -119.12 -162.83 34 11 SER A 28 ? ? -94.26 37.01 35 11 LYS A 37 ? ? -83.18 -95.25 36 11 ILE A 41 ? ? -129.42 -150.70 37 11 ASN A 108 ? ? -107.34 73.07 38 12 LYS A 37 ? ? -78.75 -75.67 39 12 ILE A 41 ? ? -119.56 -153.27 40 13 LYS A 37 ? ? -72.30 -79.38 41 13 ILE A 41 ? ? -125.04 -148.42 42 14 GLU A 6 ? ? -104.36 79.34 43 14 SER A 28 ? ? -83.11 46.50 44 14 LYS A 37 ? ? -81.03 -72.48 45 14 ILE A 41 ? ? -135.20 -146.19 46 14 ASN A 108 ? ? -107.43 78.52 47 15 GLU A 5 ? ? -165.85 -166.43 48 15 PHE A 7 ? ? -59.60 -70.43 49 15 LYS A 37 ? ? -59.62 -78.28 50 15 ILE A 41 ? ? -115.71 -146.65 51 15 ASN A 58 ? ? -73.26 33.21 52 16 ILE A 41 ? ? -107.80 -167.99 53 16 ASN A 58 ? ? -73.79 43.89 54 17 LYS A 37 ? ? -68.61 -73.29 55 17 ILE A 41 ? ? -110.33 -150.27 56 17 ASN A 140 ? ? -64.92 1.39 57 18 SER A 2 ? ? -24.77 -32.63 58 18 GLU A 5 ? ? -133.98 -95.69 59 18 LYS A 74 ? ? 71.82 30.11 60 19 LYS A 37 ? ? -77.26 -72.10 61 19 ILE A 41 ? ? -134.55 -131.53 62 20 GLU A 24 ? ? -65.13 2.34 63 20 LYS A 37 ? ? -68.35 -80.23 64 20 ILE A 41 ? ? -138.15 -141.43 65 20 ASN A 63 ? ? -99.33 46.83 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 ARG A 46 ? ? 0.124 'SIDE CHAIN' 2 2 ARG A 97 ? ? 0.082 'SIDE CHAIN' 3 3 ARG A 21 ? ? 0.241 'SIDE CHAIN' 4 3 ARG A 32 ? ? 0.089 'SIDE CHAIN' 5 5 ARG A 21 ? ? 0.077 'SIDE CHAIN' 6 5 ARG A 46 ? ? 0.114 'SIDE CHAIN' 7 5 ASP A 136 ? ? 0.074 'SIDE CHAIN' 8 8 ARG A 32 ? ? 0.099 'SIDE CHAIN' 9 10 ARG A 32 ? ? 0.121 'SIDE CHAIN' 10 12 ARG A 46 ? ? 0.099 'SIDE CHAIN' 11 13 ARG A 46 ? ? 0.113 'SIDE CHAIN' 12 14 ARG A 32 ? ? 0.116 'SIDE CHAIN' 13 16 ARG A 97 ? ? 0.110 'SIDE CHAIN' 14 19 ARG A 32 ? ? 0.301 'SIDE CHAIN' #