data_2MPO # _entry.id 2MPO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MPO RCSB RCSB103901 BMRB 15961 WWPDB D_1000103901 # _pdbx_database_related.db_id 15961 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MPO _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2014-05-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, B.' 1 'Matthews, S.' 2 # _citation.id primary _citation.title 'Structural basis of Toxoplasma gondii MIC2-Associated Protein interaction with MIC2' _citation.journal_abbrev 'To Be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Liu, B.' 1 primary 'Huynh, M.' 2 primary 'Henry, M.' 3 primary 'Liew, L.' 4 primary 'Matthews, S.J.' 5 primary 'Carruthers, V.B.' 6 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'MIC2-associated protein' _entity.formula_weight 19343.619 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP RESIDUES 47-228' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TFLELVEVPCNSVHVQGVMTPNQMVKVTGAGWDNGVLEFYVTRPTKTGGDTSRSHLASIMCYSKDIDGVPSDKAGKCFLK NFSGEDSSEIDEKEVSLPIKSHNDAFMFVCSSNDGSALQCDVFALDNTNSSDGWKVNTVDLGVSVSPDLAFGLTADGVKV KKLYASSGLTAINDDPSLGCKA ; _entity_poly.pdbx_seq_one_letter_code_can ;TFLELVEVPCNSVHVQGVMTPNQMVKVTGAGWDNGVLEFYVTRPTKTGGDTSRSHLASIMCYSKDIDGVPSDKAGKCFLK NFSGEDSSEIDEKEVSLPIKSHNDAFMFVCSSNDGSALQCDVFALDNTNSSDGWKVNTVDLGVSVSPDLAFGLTADGVKV KKLYASSGLTAINDDPSLGCKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 PHE n 1 3 LEU n 1 4 GLU n 1 5 LEU n 1 6 VAL n 1 7 GLU n 1 8 VAL n 1 9 PRO n 1 10 CYS n 1 11 ASN n 1 12 SER n 1 13 VAL n 1 14 HIS n 1 15 VAL n 1 16 GLN n 1 17 GLY n 1 18 VAL n 1 19 MET n 1 20 THR n 1 21 PRO n 1 22 ASN n 1 23 GLN n 1 24 MET n 1 25 VAL n 1 26 LYS n 1 27 VAL n 1 28 THR n 1 29 GLY n 1 30 ALA n 1 31 GLY n 1 32 TRP n 1 33 ASP n 1 34 ASN n 1 35 GLY n 1 36 VAL n 1 37 LEU n 1 38 GLU n 1 39 PHE n 1 40 TYR n 1 41 VAL n 1 42 THR n 1 43 ARG n 1 44 PRO n 1 45 THR n 1 46 LYS n 1 47 THR n 1 48 GLY n 1 49 GLY n 1 50 ASP n 1 51 THR n 1 52 SER n 1 53 ARG n 1 54 SER n 1 55 HIS n 1 56 LEU n 1 57 ALA n 1 58 SER n 1 59 ILE n 1 60 MET n 1 61 CYS n 1 62 TYR n 1 63 SER n 1 64 LYS n 1 65 ASP n 1 66 ILE n 1 67 ASP n 1 68 GLY n 1 69 VAL n 1 70 PRO n 1 71 SER n 1 72 ASP n 1 73 LYS n 1 74 ALA n 1 75 GLY n 1 76 LYS n 1 77 CYS n 1 78 PHE n 1 79 LEU n 1 80 LYS n 1 81 ASN n 1 82 PHE n 1 83 SER n 1 84 GLY n 1 85 GLU n 1 86 ASP n 1 87 SER n 1 88 SER n 1 89 GLU n 1 90 ILE n 1 91 ASP n 1 92 GLU n 1 93 LYS n 1 94 GLU n 1 95 VAL n 1 96 SER n 1 97 LEU n 1 98 PRO n 1 99 ILE n 1 100 LYS n 1 101 SER n 1 102 HIS n 1 103 ASN n 1 104 ASP n 1 105 ALA n 1 106 PHE n 1 107 MET n 1 108 PHE n 1 109 VAL n 1 110 CYS n 1 111 SER n 1 112 SER n 1 113 ASN n 1 114 ASP n 1 115 GLY n 1 116 SER n 1 117 ALA n 1 118 LEU n 1 119 GLN n 1 120 CYS n 1 121 ASP n 1 122 VAL n 1 123 PHE n 1 124 ALA n 1 125 LEU n 1 126 ASP n 1 127 ASN n 1 128 THR n 1 129 ASN n 1 130 SER n 1 131 SER n 1 132 ASP n 1 133 GLY n 1 134 TRP n 1 135 LYS n 1 136 VAL n 1 137 ASN n 1 138 THR n 1 139 VAL n 1 140 ASP n 1 141 LEU n 1 142 GLY n 1 143 VAL n 1 144 SER n 1 145 VAL n 1 146 SER n 1 147 PRO n 1 148 ASP n 1 149 LEU n 1 150 ALA n 1 151 PHE n 1 152 GLY n 1 153 LEU n 1 154 THR n 1 155 ALA n 1 156 ASP n 1 157 GLY n 1 158 VAL n 1 159 LYS n 1 160 VAL n 1 161 LYS n 1 162 LYS n 1 163 LEU n 1 164 TYR n 1 165 ALA n 1 166 SER n 1 167 SER n 1 168 GLY n 1 169 LEU n 1 170 THR n 1 171 ALA n 1 172 ILE n 1 173 ASN n 1 174 ASP n 1 175 ASP n 1 176 PRO n 1 177 SER n 1 178 LEU n 1 179 GLY n 1 180 CYS n 1 181 LYS n 1 182 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Toxoplasma gondii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5811 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET32 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q967S9_TOXGO _struct_ref.pdbx_db_accession Q967S9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TFLELVEVPCNSVHVQGVMTPNQMVKVTGAGWDNGVLEFYVTRPTKTGGDTSRSHLASIMCYSKDIDGVPSDKAGKCFLK NFSGEDSSEIDEKEVSLPIKSHNDAFMFVCSSNDGSALQCDVFALDNTNSSDGWKVNTVDLGVSVSPDLAFGLTADGVKV KKLYASSGLTAINDDPSLGCKA ; _struct_ref.pdbx_align_begin 47 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MPO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q967S9 _struct_ref_seq.db_align_beg 47 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 228 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 182 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D C(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCA' 1 6 1 '3D HNCACB' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D 1H-13C NOESY' 1 10 1 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '50 mM potassium phosphate-1, 100 mM sodium chloride-2, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker DRX 1 'Bruker DRX' 800 Bruker DRX 2 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2MPO _pdbx_nmr_refine.method 'simulated annealing, distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 1 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MPO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MPO _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1 ? ;Linge, O'Donoghue and Nilges ; refinement ARIA 2 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MPO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MPO _struct.title 'Structural basis of Toxoplasma gondii MIC2-Associated Protein interaction with MIC2' _struct.pdbx_descriptor 'MIC2-associated protein' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MPO _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'Toxoplasma gondii, Plasmodium, Microneme, Mic2, M2AP, CELL ADHESION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 175 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 179 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 175 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 179 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 180 SG ? ? A CYS 10 A CYS 180 1_555 ? ? ? ? ? ? ? 2.039 ? disulf2 disulf ? ? A CYS 61 SG ? ? ? 1_555 A CYS 77 SG ? ? A CYS 61 A CYS 77 1_555 ? ? ? ? ? ? ? 2.029 ? disulf3 disulf ? ? A CYS 110 SG ? ? ? 1_555 A CYS 120 SG ? ? A CYS 110 A CYS 120 1_555 ? ? ? ? ? ? ? 2.032 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 5 ? GLU A 7 ? LEU A 5 GLU A 7 A 2 LYS A 162 ? SER A 166 ? LYS A 162 SER A 166 A 3 VAL A 25 ? THR A 28 ? VAL A 25 THR A 28 A 4 PHE A 106 ? SER A 111 ? PHE A 106 SER A 111 A 5 GLN A 119 ? LEU A 125 ? GLN A 119 LEU A 125 A 6 TRP A 134 ? ASP A 140 ? TRP A 134 ASP A 140 B 1 ASP A 91 ? VAL A 95 ? ASP A 91 VAL A 95 B 2 LYS A 76 ? ASN A 81 ? LYS A 76 ASN A 81 B 3 ALA A 57 ? TYR A 62 ? ALA A 57 TYR A 62 B 4 GLU A 38 ? VAL A 41 ? GLU A 38 VAL A 41 B 5 PHE A 151 ? THR A 154 ? PHE A 151 THR A 154 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 6 ? N VAL A 6 O ALA A 165 ? O ALA A 165 A 2 3 O TYR A 164 ? O TYR A 164 N LYS A 26 ? N LYS A 26 A 3 4 N VAL A 25 ? N VAL A 25 O CYS A 110 ? O CYS A 110 A 4 5 N SER A 111 ? N SER A 111 O GLN A 119 ? O GLN A 119 A 5 6 N CYS A 120 ? N CYS A 120 O VAL A 139 ? O VAL A 139 B 1 2 O LYS A 93 ? O LYS A 93 N LEU A 79 ? N LEU A 79 B 2 3 O LYS A 80 ? O LYS A 80 N SER A 58 ? N SER A 58 B 3 4 O ILE A 59 ? O ILE A 59 N PHE A 39 ? N PHE A 39 B 4 5 N GLU A 38 ? N GLU A 38 O THR A 154 ? O THR A 154 # _atom_sites.entry_id 2MPO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 CYS 120 120 120 CYS CYS A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 TRP 134 134 134 TRP TRP A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 CYS 180 180 180 CYS CYS A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 ALA 182 182 182 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2014-11-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'potassium phosphate-1' 50 ? mM ? 1 'sodium chloride-2' 100 ? mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 3 ? ? -160.21 29.90 2 1 LEU A 5 ? ? -56.08 100.98 3 1 PRO A 9 ? ? -74.84 34.68 4 1 MET A 19 ? ? -157.74 -70.71 5 1 ASN A 22 ? ? 67.29 62.78 6 1 GLN A 23 ? ? -43.90 -75.43 7 1 ALA A 30 ? ? 51.54 71.64 8 1 VAL A 36 ? ? 38.45 66.81 9 1 SER A 52 ? ? -153.97 52.74 10 1 LYS A 64 ? ? -95.38 30.48 11 1 SER A 83 ? ? -59.15 84.32 12 1 SER A 87 ? ? -112.24 -78.82 13 1 GLU A 89 ? ? -178.69 136.58 14 1 LYS A 100 ? ? -150.31 81.35 15 1 SER A 101 ? ? -147.81 -16.58 16 1 ASP A 104 ? ? 71.63 -27.85 17 1 PRO A 147 ? ? -54.86 0.20 18 1 VAL A 160 ? ? -69.75 97.87 #