data_2MR6 # _entry.id 2MR6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MR6 pdb_00002mr6 10.2210/pdb2mr6/pdb RCSB RCSB103954 ? ? BMRB 25062 ? ? WWPDB D_1000103954 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25062 BMRB unspecified . NESG-OR462 TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MR6 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-07-01 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, X.' 1 'Nivon, L.' 2 'Federizon, J.F.' 3 'Maglaqui, M.' 4 'Janjua, H.' 5 'Mao, L.' 6 'Xiao, R.' 7 'Kornhaber, G.' 8 'Baker, D.' 9 'Montelione, G.T.' 10 'Szyperski, T.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 # _citation.id primary _citation.title 'Solution NMR Structure of De novo designed protein, Northeast Structural Genomics Consortium (NESG) Target OR462' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, X.' 1 ? primary 'Nivon, L.' 2 ? primary 'Federizon, J.F.' 3 ? primary 'Maglaqui, M.' 4 ? primary 'Janjua, H.' 5 ? primary 'Mao, L.' 6 ? primary 'Xiao, R.' 7 ? primary 'Kornhaber, G.' 8 ? primary 'Baker, D.' 9 ? primary 'Montelione, G.T.' 10 ? primary 'Szyperski, T.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'De novo designed Protein OR462' _entity.formula_weight 15712.907 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRV IVIIVSQDEEALRKGYEDKKKKGYDVYTSRNEDEAKKKLKEALEKSGSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRV IVIIVSQDEEALRKGYEDKKKKGYDVYTSRNEDEAKKKLKEALEKSGSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-OR462 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 VAL n 1 4 VAL n 1 5 ILE n 1 6 LEU n 1 7 VAL n 1 8 LEU n 1 9 THR n 1 10 GLY n 1 11 ASP n 1 12 GLU n 1 13 ARG n 1 14 ILE n 1 15 ALA n 1 16 GLU n 1 17 GLU n 1 18 LEU n 1 19 ARG n 1 20 LYS n 1 21 GLU n 1 22 VAL n 1 23 GLN n 1 24 LYS n 1 25 HIS n 1 26 ASP n 1 27 PRO n 1 28 ASN n 1 29 VAL n 1 30 LYS n 1 31 THR n 1 32 VAL n 1 33 PRO n 1 34 THR n 1 35 LYS n 1 36 ASP n 1 37 LYS n 1 38 GLU n 1 39 LYS n 1 40 VAL n 1 41 LYS n 1 42 GLU n 1 43 GLU n 1 44 ILE n 1 45 GLU n 1 46 LYS n 1 47 ALA n 1 48 ARG n 1 49 LYS n 1 50 GLN n 1 51 GLY n 1 52 ARG n 1 53 PRO n 1 54 ILE n 1 55 VAL n 1 56 VAL n 1 57 PHE n 1 58 VAL n 1 59 ARG n 1 60 GLY n 1 61 GLY n 1 62 ASP n 1 63 ASP n 1 64 GLU n 1 65 ARG n 1 66 ALA n 1 67 LYS n 1 68 ASP n 1 69 ILE n 1 70 ALA n 1 71 GLU n 1 72 TYR n 1 73 ALA n 1 74 GLN n 1 75 LYS n 1 76 GLU n 1 77 GLY n 1 78 LEU n 1 79 ARG n 1 80 VAL n 1 81 ILE n 1 82 VAL n 1 83 ILE n 1 84 ILE n 1 85 VAL n 1 86 SER n 1 87 GLN n 1 88 ASP n 1 89 GLU n 1 90 GLU n 1 91 ALA n 1 92 LEU n 1 93 ARG n 1 94 LYS n 1 95 GLY n 1 96 TYR n 1 97 GLU n 1 98 ASP n 1 99 LYS n 1 100 LYS n 1 101 LYS n 1 102 LYS n 1 103 GLY n 1 104 TYR n 1 105 ASP n 1 106 VAL n 1 107 TYR n 1 108 THR n 1 109 SER n 1 110 ARG n 1 111 ASN n 1 112 GLU n 1 113 ASP n 1 114 GLU n 1 115 ALA n 1 116 LYS n 1 117 LYS n 1 118 LYS n 1 119 LEU n 1 120 LYS n 1 121 GLU n 1 122 ALA n 1 123 LEU n 1 124 GLU n 1 125 LYS n 1 126 SER n 1 127 GLY n 1 128 SER n 1 129 LEU n 1 130 GLU n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n 1 135 HIS n 1 136 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'artificial gene' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21_NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2MR6 _struct_ref.pdbx_db_accession 2MR6 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MR6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 136 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2MR6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 136 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 136 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aromatic' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D simultaneous Cali,Caro, and N NOESY' 1 8 1 CCH-TOCSY 1 9 1 '3D HN(CA)CO' 1 10 1 '2D 1H-13C HSQC aliphatic' 1 11 1 '2D ct-1H-13C HSQC aliphatic' 1 12 1 '2D ct-1H-13C HSQC aromatic' 1 13 1 'GFT(4,3d) HCCHCOSY ali' 1 14 1 'gft(4,3d) HCCHCOSY caro' 1 15 1 '2D ct-1H-13C HSQC aliphatic 28ms' 1 16 1 '2D ct-1H-13C hsqc aliphatic 28ms' 1 17 1 '2D ct-1H-13C hscq aliphatic 42ms' 1 18 1 '2D cr-1H-13C hsqc aliphatic 56ms' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.2 mM OR462, 90% H2O/10% D2O,pH7.5' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 750 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2MR6 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;Structure determination was performed by running CYANA and ASDP in parallel using NOE-based constraints and PHI,PSI, and CHI1 dihedral angle constraints from TALOSN. Consensus peak assignments were selected and used in iterative refinement with CYANA. The 20 conformers out of 100 with the lowest target function were further refined by simulated annealing in explicit water bath using the program CNS with PARAM19 force field NMR Ensemble Information ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MR6 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MR6 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 7 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 10 'Bartels et al.' 'data analysis' XEASY ? 11 'Bartels et al.' 'peak picking' XEASY ? 12 'Bartels et al.' 'chemical shift assignment' XEASY ? 13 'Bruker Biospin' collection TopSpin ? 14 Varian collection VnmrJ ? 15 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOSN ? 16 '(AS-DP) Huang,Tejero,Powers, and Montelione' 'data analysis' AS-DP 1.0 17 '(AS-DP) Huang,Tejero,Powers, and Montelione' 'structure solution' AS-DP 1.0 18 'Keller and Wuthrich' 'chemical shift assignment' CARA 1.8.4 19 'Keller and Wuthrich' 'peak picking' CARA 1.8.4 20 'Bhattacharya, Montelione' 'structure validation' PSVS ? 21 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MR6 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MR6 _struct.title 'Solution NMR Structure of De novo designed protein, Northeast Structural Genomics Consortium (NESG) Target OR462' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MR6 _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 11 ? ASP A 26 ? ASP A 11 ASP A 26 1 ? 16 HELX_P HELX_P2 2 LYS A 39 ? GLY A 51 ? LYS A 39 GLY A 51 1 ? 13 HELX_P HELX_P3 3 ASP A 62 ? GLU A 76 ? ASP A 62 GLU A 76 1 ? 15 HELX_P HELX_P4 4 ASP A 88 ? LYS A 101 ? ASP A 88 LYS A 101 1 ? 14 HELX_P HELX_P5 5 ASN A 111 ? GLY A 127 ? ASN A 111 GLY A 127 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 30 ? VAL A 32 ? LYS A 30 VAL A 32 A 2 PRO A 53 ? ARG A 59 ? PRO A 53 ARG A 59 A 3 VAL A 3 ? THR A 9 ? VAL A 3 THR A 9 A 4 ARG A 79 ? VAL A 85 ? ARG A 79 VAL A 85 A 5 ASP A 105 ? SER A 109 ? ASP A 105 SER A 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 32 ? N VAL A 32 O PHE A 57 ? O PHE A 57 A 2 3 O VAL A 58 ? O VAL A 58 N THR A 9 ? N THR A 9 A 3 4 N LEU A 6 ? N LEU A 6 O ILE A 81 ? O ILE A 81 A 4 5 N VAL A 80 ? N VAL A 80 O ASP A 105 ? O ASP A 105 # _atom_sites.entry_id 2MR6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 HIS 136 136 136 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-08-06 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MR6 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2286 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 538 _pdbx_nmr_constraints.NOE_long_range_total_count 783 _pdbx_nmr_constraints.NOE_medium_range_total_count 449 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 516 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 48 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 100 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 100 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 26 ? ? -173.84 120.37 2 1 ASN A 111 ? ? -166.62 -168.36 3 1 GLU A 130 ? ? -160.40 -69.29 4 3 ASP A 62 ? ? -94.58 42.76 5 3 SER A 128 ? ? -67.44 99.49 6 3 GLU A 130 ? ? -99.22 -72.08 7 4 ASP A 36 ? ? -97.26 33.71 8 4 LEU A 129 ? ? -131.89 -67.50 9 4 HIS A 131 ? ? -156.63 32.01 10 4 HIS A 135 ? ? -148.74 -52.13 11 5 GLN A 87 ? ? -91.19 56.36 12 5 HIS A 135 ? ? -121.90 -57.69 13 6 ASP A 36 ? ? -92.00 38.90 14 6 ASP A 62 ? ? -85.78 36.78 15 7 ASP A 26 ? ? -170.09 107.96 16 7 ASN A 111 ? ? -168.80 -163.26 17 7 SER A 128 ? ? -122.67 -68.11 18 7 HIS A 132 ? ? 47.88 82.86 19 7 HIS A 135 ? ? 64.81 132.30 20 8 ASP A 62 ? ? -93.67 58.12 21 9 ASP A 36 ? ? -95.67 50.07 22 9 SER A 128 ? ? -69.97 89.30 23 9 HIS A 131 ? ? -66.32 92.10 24 9 HIS A 132 ? ? 55.46 -91.10 25 9 HIS A 133 ? ? -165.28 118.81 26 10 ASP A 26 ? ? -162.06 101.82 27 10 ASP A 36 ? ? -97.34 38.26 28 10 ASP A 62 ? ? -89.01 47.16 29 10 ASP A 88 ? ? -68.72 96.91 30 10 SER A 128 ? ? -117.16 -73.09 31 11 LEU A 129 ? ? 65.98 167.81 32 11 HIS A 131 ? ? -63.41 86.72 33 12 ASP A 62 ? ? -89.92 46.04 34 12 GLN A 87 ? ? -93.60 42.01 35 12 LEU A 129 ? ? -96.75 -65.01 36 12 HIS A 134 ? ? -150.83 -70.35 37 13 ASP A 36 ? ? -111.44 51.00 38 13 ASP A 62 ? ? -154.91 44.82 39 13 HIS A 134 ? ? 64.64 -175.90 40 13 HIS A 135 ? ? 69.26 -178.33 41 14 ASP A 26 ? ? -162.26 119.05 42 14 ASP A 36 ? ? -92.80 37.80 43 14 ASP A 62 ? ? -98.67 37.88 44 14 HIS A 133 ? ? -67.26 88.87 45 15 ASP A 26 ? ? -170.26 129.87 46 15 ASP A 36 ? ? -88.91 41.87 47 15 ASN A 111 ? ? -169.01 -162.90 48 15 GLU A 130 ? ? -91.43 -67.56 49 15 HIS A 133 ? ? 52.65 94.45 50 15 HIS A 135 ? ? -156.17 -41.00 51 16 LEU A 129 ? ? 71.05 71.95 52 16 HIS A 131 ? ? 68.70 123.85 53 16 HIS A 132 ? ? -52.65 106.06 54 16 HIS A 135 ? ? 66.88 115.36 55 17 GLN A 87 ? ? -84.89 31.27 56 17 LEU A 129 ? ? 66.07 167.50 57 17 HIS A 135 ? ? -172.22 124.37 58 18 ASP A 36 ? ? -93.29 36.25 59 18 ASP A 88 ? ? -64.38 99.20 60 18 HIS A 131 ? ? -68.18 91.36 61 19 ASP A 36 ? ? -90.59 44.49 62 19 GLU A 130 ? ? -95.64 52.36 63 19 HIS A 131 ? ? 64.18 -161.67 64 19 HIS A 134 ? ? -149.61 -58.67 65 19 HIS A 135 ? ? -161.12 106.29 66 20 HIS A 131 ? ? 55.19 74.34 67 20 HIS A 133 ? ? 60.00 99.11 #