data_2MRL # _entry.id 2MRL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MRL RCSB RCSB103968 BMRB 25083 WWPDB D_1000103968 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25083 BMRB unspecified . SSGCID-ButhA.17887.a TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MRL _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-07-09 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Barnwal, R.' 1 'Varani, G.' 2 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 3 # _citation.id primary _citation.title 'NMR structure for potential drug target from Burkholderia thailandensis E264' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Barnwal, R.' 1 primary 'Varani, G.' 2 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein BTH I2711' _entity.formula_weight 8133.304 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDRIFMTRTEALEFLLKAHQTAVDKIGHPSHKQTPADHAAIEALDRLLLDVRARRVDQFQINASAAQIIVTD _entity_poly.pdbx_seq_one_letter_code_can MDRIFMTRTEALEFLLKAHQTAVDKIGHPSHKQTPADHAAIEALDRLLLDVRARRVDQFQINASAAQIIVTD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SSGCID-ButhA.17887.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ARG n 1 4 ILE n 1 5 PHE n 1 6 MET n 1 7 THR n 1 8 ARG n 1 9 THR n 1 10 GLU n 1 11 ALA n 1 12 LEU n 1 13 GLU n 1 14 PHE n 1 15 LEU n 1 16 LEU n 1 17 LYS n 1 18 ALA n 1 19 HIS n 1 20 GLN n 1 21 THR n 1 22 ALA n 1 23 VAL n 1 24 ASP n 1 25 LYS n 1 26 ILE n 1 27 GLY n 1 28 HIS n 1 29 PRO n 1 30 SER n 1 31 HIS n 1 32 LYS n 1 33 GLN n 1 34 THR n 1 35 PRO n 1 36 ALA n 1 37 ASP n 1 38 HIS n 1 39 ALA n 1 40 ALA n 1 41 ILE n 1 42 GLU n 1 43 ALA n 1 44 LEU n 1 45 ASP n 1 46 ARG n 1 47 LEU n 1 48 LEU n 1 49 LEU n 1 50 ASP n 1 51 VAL n 1 52 ARG n 1 53 ALA n 1 54 ARG n 1 55 ARG n 1 56 VAL n 1 57 ASP n 1 58 GLN n 1 59 PHE n 1 60 GLN n 1 61 ILE n 1 62 ASN n 1 63 ALA n 1 64 SER n 1 65 ALA n 1 66 ALA n 1 67 GLN n 1 68 ILE n 1 69 ILE n 1 70 VAL n 1 71 THR n 1 72 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BTH_I2711 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'E264 / ATCC 700388 / DSM 13276 / CIP 106301' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Burkholderia thailandensis E264' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 271848 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'AVA vector' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2SV23_BURTA _struct_ref.pdbx_db_accession Q2SV23 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MDRIFMTRTEALEFLLKAHQTAVDKIGHPSHKQTPADHAAIEALDRLLLDVRARRVDQFQINASAAQIIVTD _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MRL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2SV23 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 72 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCACB' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D C(CO)NH' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '7.2 mg/mL [U-95% 13C; U-95% 15N] protein BTH I2711, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AMX 1 'Bruker AMX' 600 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MRL _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MRL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MRL _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 2 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 3 CCPN 'chemical shift assignment' CCPNMR ? 4 CCPN 'data analysis' CCPNMR ? 5 CCPN 'peak picking' CCPNMR ? 6 'Bruker Biospin' collection TOPSPIN ? 7 'Bruker Biospin' processing TOPSPIN ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MRL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MRL _struct.title ;Backbone 1H, 13C, and 15N Chemical Shift Assignments and NMR structure for potential drug target from Burkholderia thailandensis E264 ; _struct.pdbx_descriptor 'Uncharacterized protein BTH I2711' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MRL _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'UNKNOWN FUNCTION, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 10 ? ILE A 26 ? GLU A 10 ILE A 26 1 ? 17 HELX_P HELX_P2 2 ALA A 36 ? ALA A 53 ? ALA A 36 ALA A 53 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2MRL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ASP 72 72 72 ASP ASP A . n # _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center SSGCID _pdbx_SG_project.project_name ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2014-07-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_nmr_exptl_sample.component 'protein BTH_I2711' _pdbx_nmr_exptl_sample.concentration 7.2 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mg/mL _pdbx_nmr_exptl_sample.isotopic_labeling '[U-95% 13C; U-95% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 29 ? ? -69.69 -172.13 2 2 ASP A 2 ? ? -119.20 55.19 3 2 GLN A 60 ? ? -174.16 116.77 4 3 GLN A 33 ? ? -53.00 170.22 5 3 ALA A 66 ? ? -51.92 104.21 6 3 THR A 71 ? ? -112.27 75.44 7 5 PRO A 29 ? ? -69.75 -170.82 8 5 ALA A 66 ? ? -55.10 101.45 9 6 ASP A 2 ? ? -112.80 52.86 10 6 PHE A 59 ? ? -172.79 139.08 11 6 ALA A 66 ? ? -57.79 105.03 12 6 THR A 71 ? ? -109.71 75.50 13 7 MET A 6 ? ? -176.88 144.96 14 7 THR A 71 ? ? -112.28 77.97 15 8 ALA A 65 ? ? -67.23 -172.11 16 8 THR A 71 ? ? -106.94 78.27 17 9 ASP A 2 ? ? -100.25 45.66 18 9 PRO A 29 ? ? -69.77 -178.81 19 9 GLN A 33 ? ? -54.28 170.02 20 9 ALA A 63 ? ? -97.83 33.77 21 9 ALA A 65 ? ? -101.17 -70.86 22 10 ASP A 2 ? ? -98.96 33.47 23 10 PRO A 29 ? ? -69.79 -173.21 24 10 ALA A 63 ? ? -166.57 -169.61 25 10 ALA A 65 ? ? -52.48 171.46 26 10 THR A 71 ? ? -110.06 75.46 27 11 MET A 6 ? ? -176.88 144.89 28 11 THR A 71 ? ? -112.27 75.67 29 12 PRO A 29 ? ? -69.80 -174.19 30 12 THR A 71 ? ? -102.72 75.58 31 13 ASP A 2 ? ? -63.27 94.62 32 13 SER A 64 ? ? -93.71 42.17 33 13 THR A 71 ? ? -101.64 75.46 34 14 THR A 71 ? ? -112.21 75.75 35 15 ASP A 2 ? ? -62.16 95.20 36 15 PRO A 29 ? ? -69.81 -173.90 37 15 PHE A 59 ? ? -172.69 139.14 38 15 THR A 71 ? ? -111.63 76.38 39 16 ASP A 2 ? ? -96.78 47.36 40 16 PHE A 59 ? ? -172.84 146.11 41 16 SER A 64 ? ? -99.95 42.25 42 16 VAL A 70 ? ? -60.90 96.03 43 16 THR A 71 ? ? -112.34 75.67 44 17 PRO A 29 ? ? -69.73 -174.64 45 17 ALA A 65 ? ? -61.10 -173.78 46 18 THR A 71 ? ? -109.53 75.95 47 19 PRO A 29 ? ? -69.78 -176.53 48 20 ALA A 53 ? ? -95.58 31.11 49 20 ASN A 62 ? ? -138.41 -44.17 #