data_2MT4 # _entry.id 2MT4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MT4 pdb_00002mt4 10.2210/pdb2mt4/pdb RCSB RCSB104013 ? ? BMRB 25148 ? ? WWPDB D_1000104013 ? ? # _pdbx_database_related.db_id 25148 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MT4 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-08-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mobli, M.' 1 'Lewis, P.J.' 2 # _citation.id primary _citation.title 'RNA polymerase-induced remodelling of NusA produces a pause enhancement complex.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 43 _citation.page_first 2829 _citation.page_last 2840 _citation.year 2015 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25690895 _citation.pdbx_database_id_DOI 10.1093/nar/gkv108 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ma, C.' 1 ? primary 'Mobli, M.' 2 ? primary 'Yang, X.' 3 ? primary 'Keller, A.N.' 4 ? primary 'King, G.F.' 5 ? primary 'Lewis, P.J.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transcription termination/antitermination protein NusA' _entity.formula_weight 14019.858 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain (UNP residues 1-124)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSSELLDALTILEKEKGISKEIIIEAIEAALISAYKRNFNQAQNVRVDLNRETGSIRVFARKDVVDEVYDQRLEISIEEA QGIHPEYMVGDVVEIEVTPKDFGRIAAQTAKQVVTQRVREAERG ; _entity_poly.pdbx_seq_one_letter_code_can ;MSSELLDALTILEKEKGISKEIIIEAIEAALISAYKRNFNQAQNVRVDLNRETGSIRVFARKDVVDEVYDQRLEISIEEA QGIHPEYMVGDVVEIEVTPKDFGRIAAQTAKQVVTQRVREAERG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 SER n 1 4 GLU n 1 5 LEU n 1 6 LEU n 1 7 ASP n 1 8 ALA n 1 9 LEU n 1 10 THR n 1 11 ILE n 1 12 LEU n 1 13 GLU n 1 14 LYS n 1 15 GLU n 1 16 LYS n 1 17 GLY n 1 18 ILE n 1 19 SER n 1 20 LYS n 1 21 GLU n 1 22 ILE n 1 23 ILE n 1 24 ILE n 1 25 GLU n 1 26 ALA n 1 27 ILE n 1 28 GLU n 1 29 ALA n 1 30 ALA n 1 31 LEU n 1 32 ILE n 1 33 SER n 1 34 ALA n 1 35 TYR n 1 36 LYS n 1 37 ARG n 1 38 ASN n 1 39 PHE n 1 40 ASN n 1 41 GLN n 1 42 ALA n 1 43 GLN n 1 44 ASN n 1 45 VAL n 1 46 ARG n 1 47 VAL n 1 48 ASP n 1 49 LEU n 1 50 ASN n 1 51 ARG n 1 52 GLU n 1 53 THR n 1 54 GLY n 1 55 SER n 1 56 ILE n 1 57 ARG n 1 58 VAL n 1 59 PHE n 1 60 ALA n 1 61 ARG n 1 62 LYS n 1 63 ASP n 1 64 VAL n 1 65 VAL n 1 66 ASP n 1 67 GLU n 1 68 VAL n 1 69 TYR n 1 70 ASP n 1 71 GLN n 1 72 ARG n 1 73 LEU n 1 74 GLU n 1 75 ILE n 1 76 SER n 1 77 ILE n 1 78 GLU n 1 79 GLU n 1 80 ALA n 1 81 GLN n 1 82 GLY n 1 83 ILE n 1 84 HIS n 1 85 PRO n 1 86 GLU n 1 87 TYR n 1 88 MET n 1 89 VAL n 1 90 GLY n 1 91 ASP n 1 92 VAL n 1 93 VAL n 1 94 GLU n 1 95 ILE n 1 96 GLU n 1 97 VAL n 1 98 THR n 1 99 PRO n 1 100 LYS n 1 101 ASP n 1 102 PHE n 1 103 GLY n 1 104 ARG n 1 105 ILE n 1 106 ALA n 1 107 ALA n 1 108 GLN n 1 109 THR n 1 110 ALA n 1 111 LYS n 1 112 GLN n 1 113 VAL n 1 114 VAL n 1 115 THR n 1 116 GLN n 1 117 ARG n 1 118 VAL n 1 119 ARG n 1 120 GLU n 1 121 ALA n 1 122 GLU n 1 123 ARG n 1 124 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nusA, BSU16600' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 168 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pETMCSIII _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NUSA_BACSU _struct_ref.pdbx_db_accession P32727 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSSELLDALTILEKEKGISKEIIIEAIEAALISAYKRNFNQAQNVRVDLNRETGSIRVFARKDVVDEVYDQRLEISIEEA QGIHPEYMVGDVVEIEVTPKDFGRIAAQTAKQVVTQRVREAERG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MT4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P32727 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 124 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D 1H-13C NOESY aliphatic' 1 8 1 '3D 1H-13C NOESY aromatic' 1 9 1 '3D HNCACB' 1 10 1 '3D CBCA(CO)NH' 1 11 1 '3D HN(CA)CO' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.16 _pdbx_nmr_exptl_sample_conditions.pH 7.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '400 uM [U-99% 13C; U-99% 15N] NTD-NUSA, 10 mM HEPES, 150 mM sodium chloride, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MT4 _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details 'AUTOMATED NOE ASSIGNMENT PROTOCOL' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2MT4 _pdbx_nmr_details.text 'All 3D non-noesy data acquired with non-uniform sampling and processed using Maximum Entropy reconstruction' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MT4 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MT4 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 1 'Bruker Biospin' collection TopSpin 3.1 2 'J. C. Hoch & A. S. Stern' processing Rowland_NMR_Toolkit 3 3 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS + 4 CCPN 'peak picking' CCPNMR 2.2 5 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MT4 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MT4 _struct.title 'Solution structure of the N-terminal domain of NUSA from B. Subtilis' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MT4 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'Transcription factor, NUSA, RNA Polymerase, Transcription' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 4 ? LYS A 14 ? GLU A 4 LYS A 14 1 ? 11 HELX_P HELX_P2 2 LYS A 20 ? ARG A 37 ? LYS A 20 ARG A 37 1 ? 18 HELX_P HELX_P3 3 ILE A 77 ? GLY A 82 ? ILE A 77 GLY A 82 1 ? 6 HELX_P HELX_P4 4 ASP A 101 ? GLU A 122 ? ASP A 101 GLU A 122 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 46 ? ASN A 50 ? ARG A 46 ASN A 50 A 2 SER A 55 ? VAL A 65 ? SER A 55 VAL A 65 B 1 ARG A 46 ? ASN A 50 ? ARG A 46 ASN A 50 B 2 SER A 55 ? VAL A 65 ? SER A 55 VAL A 65 B 3 VAL A 92 ? GLU A 96 ? VAL A 92 GLU A 96 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 46 ? N ARG A 46 O PHE A 59 ? O PHE A 59 B 1 2 N ARG A 46 ? N ARG A 46 O PHE A 59 ? O PHE A 59 B 2 3 N ALA A 60 ? N ALA A 60 O ILE A 95 ? O ILE A 95 # _atom_sites.entry_id 2MT4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 GLY 124 124 124 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-02-18 2 'Structure model' 1 1 2015-03-04 3 'Structure model' 1 2 2015-04-01 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; 700 ;SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id NTD-NUSA-1 400 ? uM '[U-99% 13C; U-99% 15N]' 1 HEPES-2 10 ? mM ? 1 'sodium chloride-3' 150 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MT4 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2407 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 567 _pdbx_nmr_constraints.NOE_long_range_total_count 672 _pdbx_nmr_constraints.NOE_medium_range_total_count 541 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 627 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 114 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 116 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 18 ? ? -112.49 74.31 2 1 TYR A 87 ? ? -56.09 177.40 3 2 SER A 2 ? ? -131.56 -41.88 4 2 GLU A 15 ? ? -55.30 174.22 5 2 GLN A 43 ? ? -178.02 147.87 6 2 ASN A 44 ? ? -69.40 -177.92 7 2 TYR A 87 ? ? -55.97 177.01 8 3 TYR A 87 ? ? -55.40 176.15 9 4 GLN A 43 ? ? -174.50 139.87 10 4 TYR A 87 ? ? -55.82 176.43 11 5 GLN A 43 ? ? -177.09 149.04 12 5 TYR A 87 ? ? -55.15 174.80 13 7 SER A 3 ? ? -118.07 62.99 14 7 GLN A 43 ? ? -175.85 148.04 15 7 TYR A 87 ? ? -55.22 176.16 16 8 SER A 3 ? ? -104.03 56.50 17 8 ILE A 18 ? ? -108.09 70.03 18 8 PHE A 39 ? ? -156.72 69.39 19 8 GLN A 43 ? ? 179.81 158.21 20 8 TYR A 87 ? ? -55.59 176.38 21 9 GLU A 15 ? ? -60.85 -172.42 22 9 GLN A 43 ? ? -177.85 148.36 23 9 ASN A 44 ? ? -69.71 -179.18 24 9 TYR A 87 ? ? -55.71 174.92 25 10 PHE A 39 ? ? -152.78 71.74 26 10 TYR A 87 ? ? -57.89 178.30 27 11 GLN A 43 ? ? -173.97 133.21 28 11 ASN A 44 ? ? -65.36 -177.40 29 11 TYR A 87 ? ? -59.74 176.23 30 12 SER A 3 ? ? -105.89 65.61 31 12 ILE A 18 ? ? -109.92 73.27 32 12 TYR A 87 ? ? -55.95 177.27 33 13 PHE A 39 ? ? -152.09 71.98 34 13 GLN A 43 ? ? -179.28 147.94 35 13 TYR A 87 ? ? -57.01 179.93 36 14 SER A 3 ? ? -113.87 72.34 37 14 GLU A 15 ? ? -58.07 178.66 38 14 ILE A 18 ? ? -119.09 62.55 39 14 VAL A 68 ? ? -50.21 108.68 40 14 LEU A 73 ? ? -170.13 118.87 41 15 PHE A 39 ? ? -152.55 71.71 42 15 GLN A 43 ? ? -179.26 142.60 43 15 ASN A 44 ? ? -69.34 -177.48 44 15 TYR A 87 ? ? -54.16 173.35 45 16 GLU A 15 ? ? -58.82 -176.45 46 16 PHE A 39 ? ? -151.94 70.80 47 16 TYR A 87 ? ? -57.52 176.11 48 17 GLN A 43 ? ? -178.83 143.57 49 17 ASN A 44 ? ? -69.01 -179.60 50 18 TYR A 87 ? ? -56.48 178.76 51 19 GLU A 15 ? ? -60.08 -176.66 52 19 PHE A 39 ? ? -151.20 69.76 53 19 TYR A 87 ? ? -55.69 177.01 54 20 SER A 3 ? ? -108.29 48.36 55 20 GLU A 15 ? ? -60.68 -177.37 56 20 PHE A 39 ? ? -152.66 74.45 57 20 TYR A 87 ? ? -54.95 175.36 #