data_2MTG # _entry.id 2MTG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MTG RCSB RCSB104024 BMRB 25160 WWPDB D_1000104024 # _pdbx_database_related.db_id 25160 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MTG _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-08-18 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Martino, L.' 1 'Atkinson, A.R.' 2 'Kelly, G.' 3 'Conte, M.R.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Synergic interplay of the La motif, RRM1 and the interdomain linker of LARP6 in the recognition of collagen mRNA expands the RNA binding repertoire of the La module. ; 'Nucleic Acids Res.' 43 645 660 2015 NARHAD UK 0305-1048 0389 ? 25488812 10.1093/nar/gku1287 1 '1H, 15N and 13C chemical shift assignments of the La motif and RRM1 from human LARP6' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Martino, L.' 1 primary 'Pennell, S.' 2 primary 'Kelly, G.' 3 primary 'Busi, B.' 4 primary 'Brown, P.' 5 primary 'Atkinson, R.A.' 6 primary 'Salisbury, N.J.' 7 primary 'Ooi, Z.H.' 8 primary 'See, K.W.' 9 primary 'Smerdon, S.J.' 10 primary 'Alfano, C.' 11 primary 'Bui, T.T.' 12 primary 'Conte, M.R.' 13 1 'Martino, L.' 14 1 'Pennell, S.' 15 1 'Kelly, G.' 16 1 'Busi, B.' 17 1 'Brown, P.' 18 1 'Atkinson, A.R.' 19 1 'Salisbury, N.JH.' 20 1 'Ooi, Z.H.' 21 1 'See, K.W.' 22 1 'Smerdon, S.J.' 23 1 'Alfano, C.' 24 1 'Bui, T.' 25 1 'Conte, M.R.' 26 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'La-related protein 6' _entity.formula_weight 13432.703 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Acheron, Achn, La ribonucleoprotein domain family member 6' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQ ECAIVEFEEVEAAIKAHEFMITESQGKENMKAVLIGMKP ; _entity_poly.pdbx_seq_one_letter_code_can ;GNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQ ECAIVEFEEVEAAIKAHEFMITESQGKENMKAVLIGMKP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASN n 1 3 GLU n 1 4 ASN n 1 5 LEU n 1 6 PRO n 1 7 SER n 1 8 LYS n 1 9 MET n 1 10 LEU n 1 11 LEU n 1 12 VAL n 1 13 TYR n 1 14 ASP n 1 15 LEU n 1 16 TYR n 1 17 LEU n 1 18 SER n 1 19 PRO n 1 20 LYS n 1 21 LEU n 1 22 TRP n 1 23 ALA n 1 24 LEU n 1 25 ALA n 1 26 THR n 1 27 PRO n 1 28 GLN n 1 29 LYS n 1 30 ASN n 1 31 GLY n 1 32 ARG n 1 33 VAL n 1 34 GLN n 1 35 GLU n 1 36 LYS n 1 37 VAL n 1 38 MET n 1 39 GLU n 1 40 HIS n 1 41 LEU n 1 42 LEU n 1 43 LYS n 1 44 LEU n 1 45 PHE n 1 46 GLY n 1 47 THR n 1 48 PHE n 1 49 GLY n 1 50 VAL n 1 51 ILE n 1 52 SER n 1 53 SER n 1 54 VAL n 1 55 ARG n 1 56 ILE n 1 57 LEU n 1 58 LYS n 1 59 PRO n 1 60 GLY n 1 61 ARG n 1 62 GLU n 1 63 LEU n 1 64 PRO n 1 65 PRO n 1 66 ASP n 1 67 ILE n 1 68 ARG n 1 69 ARG n 1 70 ILE n 1 71 SER n 1 72 SER n 1 73 ARG n 1 74 TYR n 1 75 SER n 1 76 GLN n 1 77 VAL n 1 78 GLY n 1 79 THR n 1 80 GLN n 1 81 GLU n 1 82 CYS n 1 83 ALA n 1 84 ILE n 1 85 VAL n 1 86 GLU n 1 87 PHE n 1 88 GLU n 1 89 GLU n 1 90 VAL n 1 91 GLU n 1 92 ALA n 1 93 ALA n 1 94 ILE n 1 95 LYS n 1 96 ALA n 1 97 HIS n 1 98 GLU n 1 99 PHE n 1 100 MET n 1 101 ILE n 1 102 THR n 1 103 GLU n 1 104 SER n 1 105 GLN n 1 106 GLY n 1 107 LYS n 1 108 GLU n 1 109 ASN n 1 110 MET n 1 111 LYS n 1 112 ALA n 1 113 VAL n 1 114 LEU n 1 115 ILE n 1 116 GLY n 1 117 MET n 1 118 LYS n 1 119 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LARP6 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-duet1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LARP6_HUMAN _struct_ref.pdbx_db_accession Q9BRS8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NENLPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQE CAIVEFEEVEAAIKAHEFMITESQGKENMKAVLIGMKP ; _struct_ref.pdbx_align_begin 178 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MTG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 119 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BRS8 _struct_ref_seq.db_align_beg 178 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 295 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 178 _struct_ref_seq.pdbx_auth_seq_align_end 295 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2MTG _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9BRS8 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'EXPRESSION TAG' _struct_ref_seq_dif.pdbx_auth_seq_num 177 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D HNCACB' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY aliphatic' 1 9 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 7.25 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.3-0.7 mM [U-95% 13C; U-95% 15N] LARP6 RRM1, 50 mM TRIS, 100 mM potassium chloride, 1 mM DTT, 10 % [U-100% 2H] D2O, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 700 Bruker Avance 2 'Bruker Avance' 500 Bruker Avance 3 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MTG _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MTG _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MTG _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.21 1 'Bartels et al.' 'chemical shift assignment' XEASY ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MTG _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MTG _struct.title 'Solution structure of the RRM1 of human LARP6' _struct.pdbx_descriptor 'La-related protein 6' _struct.pdbx_model_details 'closest to the average, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MTG _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'LARP6, RRM, La-related proteins, Acheron, LARP, RNA Binding Protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 32 ? GLY A 49 ? ARG A 208 GLY A 225 1 ? 18 HELX_P HELX_P2 2 PRO A 64 ? SER A 71 ? PRO A 240 SER A 247 1 ? 8 HELX_P HELX_P3 3 GLU A 89 ? SER A 104 ? GLU A 265 SER A 280 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 51 ? LEU A 57 ? ILE A 227 LEU A 233 A 2 CYS A 82 ? PHE A 87 ? CYS A 258 PHE A 263 A 3 MET A 9 ? TYR A 13 ? MET A 185 TYR A 189 A 4 LYS A 111 ? ILE A 115 ? LYS A 287 ILE A 291 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 55 ? N ARG A 231 O ILE A 84 ? O ILE A 260 A 2 3 O ALA A 83 ? O ALA A 259 N VAL A 12 ? N VAL A 188 A 3 4 N TYR A 13 ? N TYR A 189 O LYS A 111 ? O LYS A 287 # _atom_sites.entry_id 2MTG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 177 ? ? ? A . n A 1 2 ASN 2 178 ? ? ? A . n A 1 3 GLU 3 179 ? ? ? A . n A 1 4 ASN 4 180 180 ASN ASN A . n A 1 5 LEU 5 181 181 LEU LEU A . n A 1 6 PRO 6 182 182 PRO PRO A . n A 1 7 SER 7 183 183 SER SER A . n A 1 8 LYS 8 184 184 LYS LYS A . n A 1 9 MET 9 185 185 MET MET A . n A 1 10 LEU 10 186 186 LEU LEU A . n A 1 11 LEU 11 187 187 LEU LEU A . n A 1 12 VAL 12 188 188 VAL VAL A . n A 1 13 TYR 13 189 189 TYR TYR A . n A 1 14 ASP 14 190 190 ASP ASP A . n A 1 15 LEU 15 191 191 LEU LEU A . n A 1 16 TYR 16 192 192 TYR TYR A . n A 1 17 LEU 17 193 193 LEU LEU A . n A 1 18 SER 18 194 194 SER SER A . n A 1 19 PRO 19 195 195 PRO PRO A . n A 1 20 LYS 20 196 196 LYS LYS A . n A 1 21 LEU 21 197 197 LEU LEU A . n A 1 22 TRP 22 198 198 TRP TRP A . n A 1 23 ALA 23 199 199 ALA ALA A . n A 1 24 LEU 24 200 200 LEU LEU A . n A 1 25 ALA 25 201 201 ALA ALA A . n A 1 26 THR 26 202 202 THR THR A . n A 1 27 PRO 27 203 203 PRO PRO A . n A 1 28 GLN 28 204 204 GLN GLN A . n A 1 29 LYS 29 205 205 LYS LYS A . n A 1 30 ASN 30 206 206 ASN ASN A . n A 1 31 GLY 31 207 207 GLY GLY A . n A 1 32 ARG 32 208 208 ARG ARG A . n A 1 33 VAL 33 209 209 VAL VAL A . n A 1 34 GLN 34 210 210 GLN GLN A . n A 1 35 GLU 35 211 211 GLU GLU A . n A 1 36 LYS 36 212 212 LYS LYS A . n A 1 37 VAL 37 213 213 VAL VAL A . n A 1 38 MET 38 214 214 MET MET A . n A 1 39 GLU 39 215 215 GLU GLU A . n A 1 40 HIS 40 216 216 HIS HIS A . n A 1 41 LEU 41 217 217 LEU LEU A . n A 1 42 LEU 42 218 218 LEU LEU A . n A 1 43 LYS 43 219 219 LYS LYS A . n A 1 44 LEU 44 220 220 LEU LEU A . n A 1 45 PHE 45 221 221 PHE PHE A . n A 1 46 GLY 46 222 222 GLY GLY A . n A 1 47 THR 47 223 223 THR THR A . n A 1 48 PHE 48 224 224 PHE PHE A . n A 1 49 GLY 49 225 225 GLY GLY A . n A 1 50 VAL 50 226 226 VAL VAL A . n A 1 51 ILE 51 227 227 ILE ILE A . n A 1 52 SER 52 228 228 SER SER A . n A 1 53 SER 53 229 229 SER SER A . n A 1 54 VAL 54 230 230 VAL VAL A . n A 1 55 ARG 55 231 231 ARG ARG A . n A 1 56 ILE 56 232 232 ILE ILE A . n A 1 57 LEU 57 233 233 LEU LEU A . n A 1 58 LYS 58 234 234 LYS LYS A . n A 1 59 PRO 59 235 235 PRO PRO A . n A 1 60 GLY 60 236 236 GLY GLY A . n A 1 61 ARG 61 237 237 ARG ARG A . n A 1 62 GLU 62 238 238 GLU GLU A . n A 1 63 LEU 63 239 239 LEU LEU A . n A 1 64 PRO 64 240 240 PRO PRO A . n A 1 65 PRO 65 241 241 PRO PRO A . n A 1 66 ASP 66 242 242 ASP ASP A . n A 1 67 ILE 67 243 243 ILE ILE A . n A 1 68 ARG 68 244 244 ARG ARG A . n A 1 69 ARG 69 245 245 ARG ARG A . n A 1 70 ILE 70 246 246 ILE ILE A . n A 1 71 SER 71 247 247 SER SER A . n A 1 72 SER 72 248 248 SER SER A . n A 1 73 ARG 73 249 249 ARG ARG A . n A 1 74 TYR 74 250 250 TYR TYR A . n A 1 75 SER 75 251 251 SER SER A . n A 1 76 GLN 76 252 252 GLN GLN A . n A 1 77 VAL 77 253 253 VAL VAL A . n A 1 78 GLY 78 254 254 GLY GLY A . n A 1 79 THR 79 255 255 THR THR A . n A 1 80 GLN 80 256 256 GLN GLN A . n A 1 81 GLU 81 257 257 GLU GLU A . n A 1 82 CYS 82 258 258 CYS CYS A . n A 1 83 ALA 83 259 259 ALA ALA A . n A 1 84 ILE 84 260 260 ILE ILE A . n A 1 85 VAL 85 261 261 VAL VAL A . n A 1 86 GLU 86 262 262 GLU GLU A . n A 1 87 PHE 87 263 263 PHE PHE A . n A 1 88 GLU 88 264 264 GLU GLU A . n A 1 89 GLU 89 265 265 GLU GLU A . n A 1 90 VAL 90 266 266 VAL VAL A . n A 1 91 GLU 91 267 267 GLU GLU A . n A 1 92 ALA 92 268 268 ALA ALA A . n A 1 93 ALA 93 269 269 ALA ALA A . n A 1 94 ILE 94 270 270 ILE ILE A . n A 1 95 LYS 95 271 271 LYS LYS A . n A 1 96 ALA 96 272 272 ALA ALA A . n A 1 97 HIS 97 273 273 HIS HIS A . n A 1 98 GLU 98 274 274 GLU GLU A . n A 1 99 PHE 99 275 275 PHE PHE A . n A 1 100 MET 100 276 276 MET MET A . n A 1 101 ILE 101 277 277 ILE ILE A . n A 1 102 THR 102 278 278 THR THR A . n A 1 103 GLU 103 279 279 GLU GLU A . n A 1 104 SER 104 280 280 SER SER A . n A 1 105 GLN 105 281 281 GLN GLN A . n A 1 106 GLY 106 282 282 GLY GLY A . n A 1 107 LYS 107 283 283 LYS LYS A . n A 1 108 GLU 108 284 284 GLU GLU A . n A 1 109 ASN 109 285 285 ASN ASN A . n A 1 110 MET 110 286 286 MET MET A . n A 1 111 LYS 111 287 287 LYS LYS A . n A 1 112 ALA 112 288 288 ALA ALA A . n A 1 113 VAL 113 289 289 VAL VAL A . n A 1 114 LEU 114 290 290 LEU LEU A . n A 1 115 ILE 115 291 291 ILE ILE A . n A 1 116 GLY 116 292 292 GLY GLY A . n A 1 117 MET 117 293 293 MET MET A . n A 1 118 LYS 118 294 294 LYS LYS A . n A 1 119 PRO 119 295 295 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-12-24 2 'Structure model' 1 1 2015-01-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'LARP6 RRM1-1' ? 0.3-0.7 mM '[U-95% 13C; U-95% 15N]' 1 TRIS-2 50 ? mM ? 1 'potassium chloride-3' 100 ? mM ? 1 DTT-4 1 ? mM ? 1 D2O-5 10 ? % '[U-100% 2H]' 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ALA 269 ? ? H A HIS 273 ? ? 1.60 2 2 O A ARG 231 ? ? H A ILE 260 ? ? 1.56 3 3 O A ARG 231 ? ? H A ILE 260 ? ? 1.56 4 3 H A ARG 231 ? ? O A ILE 260 ? ? 1.60 5 4 H A SER 228 ? ? O A GLU 262 ? ? 1.42 6 5 O A ARG 231 ? ? H A ILE 260 ? ? 1.52 7 5 O A HIS 273 ? ? H A ILE 277 ? ? 1.58 8 5 O A MET 276 ? ? H A SER 280 ? ? 1.59 9 6 O A ALA 269 ? ? H A HIS 273 ? ? 1.58 10 7 H A SER 228 ? ? O A GLU 262 ? ? 1.41 11 8 O A ARG 231 ? ? H A ILE 260 ? ? 1.52 12 9 O A ARG 231 ? ? H A ILE 260 ? ? 1.57 13 9 H A SER 228 ? ? O A GLU 262 ? ? 1.59 14 10 O A ALA 269 ? ? H A HIS 273 ? ? 1.59 15 10 H A ARG 231 ? ? O A ILE 260 ? ? 1.60 16 11 H A SER 228 ? ? O A GLU 262 ? ? 1.58 17 11 O A HIS 273 ? ? H A ILE 277 ? ? 1.59 18 12 O A ALA 269 ? ? H A HIS 273 ? ? 1.60 19 13 O A ARG 231 ? ? H A ILE 260 ? ? 1.55 20 13 O A ALA 269 ? ? H A HIS 273 ? ? 1.59 21 14 O A ARG 231 ? ? H A ILE 260 ? ? 1.58 22 14 H A ARG 231 ? ? O A ILE 260 ? ? 1.60 23 15 H A VAL 188 ? ? O A ALA 259 ? ? 1.59 24 16 H A ARG 231 ? ? O A ILE 260 ? ? 1.57 25 17 O A ARG 231 ? ? H A ILE 260 ? ? 1.58 26 18 H A SER 228 ? ? O A GLU 262 ? ? 1.59 27 19 H A VAL 188 ? ? O A ALA 259 ? ? 1.58 28 19 H A SER 228 ? ? O A GLU 262 ? ? 1.58 29 19 O A ALA 269 ? ? H A HIS 273 ? ? 1.59 30 19 O A ARG 231 ? ? H A ILE 260 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 184 ? ? -162.10 72.76 2 1 ALA A 201 ? ? 55.56 99.38 3 1 ASN A 206 ? ? -70.23 -77.24 4 1 ARG A 208 ? ? -49.21 -154.77 5 1 ARG A 237 ? ? -137.37 -85.32 6 1 TYR A 250 ? ? -92.33 39.09 7 1 GLN A 252 ? ? -174.47 -26.37 8 1 MET A 286 ? ? -30.23 126.10 9 2 LYS A 184 ? ? 172.50 76.20 10 2 ASP A 190 ? ? 37.25 44.71 11 2 ALA A 201 ? ? 64.23 101.79 12 2 LYS A 205 ? ? -144.18 -63.30 13 2 ASN A 206 ? ? -162.65 -71.79 14 2 ARG A 208 ? ? -47.34 -155.49 15 2 ARG A 237 ? ? -132.25 -153.51 16 2 GLU A 238 ? ? -55.35 97.67 17 2 TYR A 250 ? ? -90.69 44.79 18 2 GLN A 252 ? ? -179.72 -26.09 19 2 MET A 286 ? ? -30.77 130.38 20 2 MET A 293 ? ? -176.21 96.08 21 3 LYS A 184 ? ? -160.40 73.24 22 3 ASP A 190 ? ? -18.57 72.46 23 3 ALA A 201 ? ? 44.40 92.38 24 3 GLN A 204 ? ? -93.85 44.46 25 3 ARG A 208 ? ? -42.31 -160.13 26 3 SER A 229 ? ? -171.73 144.13 27 3 PRO A 235 ? ? -46.78 165.53 28 3 ARG A 237 ? ? -135.32 -87.31 29 3 TYR A 250 ? ? -96.63 39.18 30 3 GLN A 252 ? ? -178.33 -25.93 31 3 VAL A 253 ? ? -78.98 20.47 32 3 LYS A 283 ? ? -106.62 -168.65 33 3 MET A 286 ? ? -32.97 110.34 34 3 MET A 293 ? ? -176.87 102.93 35 4 LYS A 184 ? ? 176.79 75.12 36 4 ASP A 190 ? ? -23.42 87.71 37 4 GLN A 204 ? ? -156.80 29.96 38 4 ARG A 208 ? ? -46.89 -156.18 39 4 PRO A 235 ? ? -44.33 165.14 40 4 ARG A 237 ? ? -149.01 -82.31 41 4 TYR A 250 ? ? -93.19 42.55 42 4 SER A 251 ? ? -45.96 94.37 43 4 GLN A 252 ? ? -149.43 -32.77 44 4 GLU A 265 ? ? -172.52 143.93 45 4 GLU A 284 ? ? -69.85 67.97 46 4 MET A 286 ? ? -37.74 115.25 47 5 LYS A 184 ? ? -173.33 79.10 48 5 ALA A 201 ? ? 63.71 131.47 49 5 PRO A 203 ? ? -57.62 -175.36 50 5 ASN A 206 ? ? 64.37 -78.38 51 5 ARG A 208 ? ? -48.86 -154.73 52 5 ARG A 237 ? ? -114.07 -86.84 53 5 TYR A 250 ? ? -94.21 38.69 54 5 GLN A 252 ? ? 178.53 -26.03 55 5 MET A 286 ? ? -27.90 114.75 56 5 MET A 293 ? ? -173.97 115.70 57 6 LYS A 184 ? ? -164.39 73.49 58 6 ALA A 201 ? ? 72.76 -156.93 59 6 LYS A 205 ? ? -160.10 -56.55 60 6 ARG A 208 ? ? -46.60 -155.40 61 6 SER A 229 ? ? -171.63 144.16 62 6 ARG A 237 ? ? -136.74 -86.84 63 6 TYR A 250 ? ? -86.88 39.65 64 6 GLN A 252 ? ? -177.76 -26.37 65 6 GLU A 284 ? ? -67.16 73.96 66 6 MET A 286 ? ? -33.32 104.00 67 7 LYS A 184 ? ? -156.35 74.75 68 7 ASP A 190 ? ? -11.33 72.95 69 7 ALA A 201 ? ? 54.17 109.07 70 7 PRO A 203 ? ? -55.89 -166.70 71 7 LYS A 205 ? ? -168.48 -44.80 72 7 ARG A 208 ? ? -45.98 -155.36 73 7 PRO A 235 ? ? -46.66 162.72 74 7 ARG A 237 ? ? -138.58 -85.29 75 7 TYR A 250 ? ? -95.28 38.38 76 7 GLN A 252 ? ? -170.86 -26.49 77 7 GLU A 284 ? ? -66.22 70.21 78 7 MET A 286 ? ? -34.37 129.93 79 8 LYS A 184 ? ? 173.76 76.64 80 8 ALA A 201 ? ? 59.21 113.13 81 8 ASN A 206 ? ? -172.53 105.45 82 8 ARG A 208 ? ? -46.70 -155.65 83 8 SER A 229 ? ? -170.19 143.91 84 8 ARG A 237 ? ? -139.07 -156.03 85 8 GLU A 238 ? ? -52.39 98.27 86 8 TYR A 250 ? ? -92.47 39.62 87 8 GLN A 252 ? ? -177.17 -26.42 88 8 VAL A 253 ? ? -77.03 21.64 89 8 LYS A 283 ? ? -107.02 -167.00 90 8 MET A 286 ? ? -26.40 130.78 91 9 LYS A 184 ? ? -173.45 75.53 92 9 ASN A 206 ? ? 174.11 77.11 93 9 ARG A 208 ? ? -45.15 -158.73 94 9 SER A 229 ? ? -170.56 143.55 95 9 ARG A 237 ? ? -134.29 -74.65 96 9 TYR A 250 ? ? -92.47 39.10 97 9 GLN A 252 ? ? -172.76 -26.19 98 9 GLU A 284 ? ? -68.50 68.32 99 10 LYS A 184 ? ? 175.50 81.57 100 10 ASP A 190 ? ? -13.22 75.10 101 10 GLN A 204 ? ? -169.00 -52.74 102 10 ARG A 208 ? ? -47.29 -155.55 103 10 SER A 229 ? ? -171.71 144.26 104 10 ARG A 237 ? ? -118.26 -77.91 105 10 TYR A 250 ? ? -91.01 38.62 106 10 GLN A 252 ? ? 179.54 -25.33 107 10 VAL A 253 ? ? -78.13 23.89 108 10 MET A 286 ? ? -28.26 131.87 109 10 MET A 293 ? ? 68.10 143.05 110 10 LYS A 294 ? ? 61.66 93.21 111 11 LYS A 184 ? ? -170.83 79.49 112 11 ALA A 201 ? ? -176.57 144.10 113 11 LYS A 205 ? ? 68.30 -70.18 114 11 ASN A 206 ? ? -67.06 -165.34 115 11 ARG A 208 ? ? -47.05 -155.12 116 11 SER A 229 ? ? -172.45 143.69 117 11 PRO A 235 ? ? -48.17 156.22 118 11 ARG A 237 ? ? -136.25 -79.91 119 11 TYR A 250 ? ? -91.90 38.85 120 11 GLN A 252 ? ? -175.70 -26.42 121 11 GLU A 284 ? ? -68.29 72.03 122 11 MET A 286 ? ? -28.63 122.19 123 11 MET A 293 ? ? -161.13 -89.34 124 11 LYS A 294 ? ? 32.07 91.81 125 12 LYS A 184 ? ? -173.20 78.93 126 12 ALA A 201 ? ? 56.39 109.88 127 12 GLN A 204 ? ? 62.07 119.26 128 12 LYS A 205 ? ? -177.37 -59.17 129 12 ASN A 206 ? ? -174.53 -53.02 130 12 ARG A 208 ? ? -45.53 -157.09 131 12 ARG A 237 ? ? -118.71 -79.05 132 12 TYR A 250 ? ? -99.03 38.60 133 12 GLN A 252 ? ? -178.50 -25.74 134 12 MET A 286 ? ? -27.79 136.57 135 13 LYS A 184 ? ? -174.56 78.00 136 13 ALA A 201 ? ? 65.93 125.07 137 13 GLN A 204 ? ? -178.46 145.66 138 13 LYS A 205 ? ? -156.02 -46.24 139 13 ASN A 206 ? ? -168.14 64.22 140 13 ARG A 208 ? ? -43.31 -158.36 141 13 ARG A 237 ? ? -135.77 -76.47 142 13 TYR A 250 ? ? -96.66 38.57 143 13 GLN A 252 ? ? -166.49 -26.41 144 14 PRO A 182 ? ? -74.43 -70.67 145 14 LYS A 184 ? ? -179.03 75.21 146 14 LEU A 193 ? ? -69.13 12.61 147 14 ALA A 201 ? ? 67.52 -71.04 148 14 PRO A 203 ? ? -76.43 -167.96 149 14 LYS A 205 ? ? 60.62 169.14 150 14 ARG A 208 ? ? -43.94 -159.82 151 14 ARG A 237 ? ? -140.78 -86.27 152 14 TYR A 250 ? ? -93.53 39.55 153 14 GLN A 252 ? ? -166.71 -28.11 154 14 MET A 286 ? ? -27.46 136.16 155 14 MET A 293 ? ? -57.76 -179.55 156 14 LYS A 294 ? ? 64.29 103.90 157 15 LYS A 184 ? ? -178.57 75.20 158 15 ASP A 190 ? ? -13.03 76.82 159 15 ALA A 201 ? ? 61.71 162.52 160 15 LYS A 205 ? ? 179.78 155.37 161 15 ARG A 208 ? ? -47.61 -155.27 162 15 PRO A 235 ? ? -48.09 165.77 163 15 ARG A 237 ? ? -142.13 -89.81 164 15 TYR A 250 ? ? -90.88 38.33 165 15 GLN A 252 ? ? -175.98 -26.36 166 15 LYS A 283 ? ? -105.87 -167.10 167 15 MET A 286 ? ? -37.26 127.11 168 15 MET A 293 ? ? -134.20 -46.83 169 16 LYS A 184 ? ? -174.80 74.39 170 16 ALA A 201 ? ? 63.55 110.57 171 16 LYS A 205 ? ? -177.14 -50.46 172 16 ASN A 206 ? ? -177.55 102.32 173 16 ARG A 208 ? ? -43.93 -158.99 174 16 ARG A 237 ? ? -140.46 -89.06 175 16 GLN A 252 ? ? 173.43 -26.50 176 16 MET A 286 ? ? -28.10 110.38 177 16 MET A 293 ? ? -156.51 -56.04 178 17 LYS A 184 ? ? 178.32 75.49 179 17 ASP A 190 ? ? -11.32 72.82 180 17 ALA A 201 ? ? 56.32 99.75 181 17 PRO A 203 ? ? -74.57 -167.70 182 17 LYS A 205 ? ? -171.97 -41.34 183 17 ASN A 206 ? ? -151.10 -67.78 184 17 ARG A 208 ? ? -48.03 -155.45 185 17 ARG A 237 ? ? -128.41 -88.49 186 17 TYR A 250 ? ? -90.78 44.21 187 17 GLN A 252 ? ? -178.46 -26.87 188 17 GLU A 284 ? ? -102.32 61.19 189 17 MET A 286 ? ? -28.24 110.40 190 17 MET A 293 ? ? -176.91 138.04 191 17 LYS A 294 ? ? -164.19 -65.33 192 18 PRO A 182 ? ? -81.15 -76.77 193 18 LYS A 184 ? ? 176.33 78.73 194 18 ASP A 190 ? ? 71.42 39.25 195 18 GLN A 204 ? ? -172.24 -52.93 196 18 ARG A 208 ? ? -48.39 -155.17 197 18 PRO A 235 ? ? -37.93 166.87 198 18 ARG A 237 ? ? -135.79 -109.40 199 18 TYR A 250 ? ? -89.32 38.85 200 18 GLN A 252 ? ? -171.74 -26.58 201 18 MET A 286 ? ? -29.11 119.64 202 19 LYS A 184 ? ? 174.41 77.09 203 19 ASP A 190 ? ? -13.09 76.66 204 19 ALA A 201 ? ? 63.56 -176.10 205 19 LYS A 205 ? ? -175.48 147.77 206 19 ARG A 208 ? ? -47.28 -155.56 207 19 SER A 229 ? ? -171.25 143.91 208 19 ARG A 237 ? ? -140.55 -86.03 209 19 TYR A 250 ? ? -89.00 38.78 210 19 GLN A 252 ? ? -168.45 -29.33 211 19 MET A 286 ? ? -36.08 128.44 212 19 MET A 293 ? ? 67.34 -72.21 213 20 LYS A 184 ? ? 176.71 72.82 214 20 ASP A 190 ? ? -26.01 72.22 215 20 ALA A 201 ? ? 61.46 114.13 216 20 ASN A 206 ? ? -148.62 -47.36 217 20 ARG A 208 ? ? -48.71 -155.19 218 20 ARG A 237 ? ? -129.17 -86.39 219 20 TYR A 250 ? ? -91.02 39.03 220 20 GLN A 252 ? ? -171.37 -31.34 221 20 MET A 286 ? ? -39.62 121.59 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 177 ? A GLY 1 2 1 Y 1 A ASN 178 ? A ASN 2 3 1 Y 1 A GLU 179 ? A GLU 3 4 2 Y 1 A GLY 177 ? A GLY 1 5 2 Y 1 A ASN 178 ? A ASN 2 6 2 Y 1 A GLU 179 ? A GLU 3 7 3 Y 1 A GLY 177 ? A GLY 1 8 3 Y 1 A ASN 178 ? A ASN 2 9 3 Y 1 A GLU 179 ? A GLU 3 10 4 Y 1 A GLY 177 ? A GLY 1 11 4 Y 1 A ASN 178 ? A ASN 2 12 4 Y 1 A GLU 179 ? A GLU 3 13 5 Y 1 A GLY 177 ? A GLY 1 14 5 Y 1 A ASN 178 ? A ASN 2 15 5 Y 1 A GLU 179 ? A GLU 3 16 6 Y 1 A GLY 177 ? A GLY 1 17 6 Y 1 A ASN 178 ? A ASN 2 18 6 Y 1 A GLU 179 ? A GLU 3 19 7 Y 1 A GLY 177 ? A GLY 1 20 7 Y 1 A ASN 178 ? A ASN 2 21 7 Y 1 A GLU 179 ? A GLU 3 22 8 Y 1 A GLY 177 ? A GLY 1 23 8 Y 1 A ASN 178 ? A ASN 2 24 8 Y 1 A GLU 179 ? A GLU 3 25 9 Y 1 A GLY 177 ? A GLY 1 26 9 Y 1 A ASN 178 ? A ASN 2 27 9 Y 1 A GLU 179 ? A GLU 3 28 10 Y 1 A GLY 177 ? A GLY 1 29 10 Y 1 A ASN 178 ? A ASN 2 30 10 Y 1 A GLU 179 ? A GLU 3 31 11 Y 1 A GLY 177 ? A GLY 1 32 11 Y 1 A ASN 178 ? A ASN 2 33 11 Y 1 A GLU 179 ? A GLU 3 34 12 Y 1 A GLY 177 ? A GLY 1 35 12 Y 1 A ASN 178 ? A ASN 2 36 12 Y 1 A GLU 179 ? A GLU 3 37 13 Y 1 A GLY 177 ? A GLY 1 38 13 Y 1 A ASN 178 ? A ASN 2 39 13 Y 1 A GLU 179 ? A GLU 3 40 14 Y 1 A GLY 177 ? A GLY 1 41 14 Y 1 A ASN 178 ? A ASN 2 42 14 Y 1 A GLU 179 ? A GLU 3 43 15 Y 1 A GLY 177 ? A GLY 1 44 15 Y 1 A ASN 178 ? A ASN 2 45 15 Y 1 A GLU 179 ? A GLU 3 46 16 Y 1 A GLY 177 ? A GLY 1 47 16 Y 1 A ASN 178 ? A ASN 2 48 16 Y 1 A GLU 179 ? A GLU 3 49 17 Y 1 A GLY 177 ? A GLY 1 50 17 Y 1 A ASN 178 ? A ASN 2 51 17 Y 1 A GLU 179 ? A GLU 3 52 18 Y 1 A GLY 177 ? A GLY 1 53 18 Y 1 A ASN 178 ? A ASN 2 54 18 Y 1 A GLU 179 ? A GLU 3 55 19 Y 1 A GLY 177 ? A GLY 1 56 19 Y 1 A ASN 178 ? A ASN 2 57 19 Y 1 A GLU 179 ? A GLU 3 58 20 Y 1 A GLY 177 ? A GLY 1 59 20 Y 1 A ASN 178 ? A ASN 2 60 20 Y 1 A GLU 179 ? A GLU 3 #