data_2MTQ # _entry.id 2MTQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MTQ pdb_00002mtq 10.2210/pdb2mtq/pdb RCSB RCSB104033 ? ? BMRB 25177 ? ? WWPDB D_1000104033 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2A3D PDB . unspecified 25177 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MTQ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-08-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Plegaria, J.S.' 1 'Zuiderweg, E.R.' 2 'Stemmler, T.L.' 3 'Pecoraro, V.L.' 4 # _citation.id primary _citation.title ;Apoprotein Structure and Metal Binding Characterization of a de Novo Designed Peptide, alpha 3DIV, that Sequesters Toxic Heavy Metals. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 54 _citation.page_first 2858 _citation.page_last 2873 _citation.year 2015 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25790102 _citation.pdbx_database_id_DOI 10.1021/acs.biochem.5b00064 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Plegaria, J.S.' 1 ? primary 'Dzul, S.P.' 2 ? primary 'Zuiderweg, E.R.' 3 ? primary 'Stemmler, T.L.' 4 ? primary 'Pecoraro, V.L.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Designed Peptide' _entity.formula_weight 8090.083 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGSWAEFKQRLAAIKTRCQALGGSEAECAAFEKEIAAFESELQAYKGKGNPEVEALRKEAAAIRDECQAYRHN _entity_poly.pdbx_seq_one_letter_code_can MGSWAEFKQRLAAIKTRCQALGGSEAECAAFEKEIAAFESELQAYKGKGNPEVEALRKEAAAIRDECQAYRHN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 TRP n 1 5 ALA n 1 6 GLU n 1 7 PHE n 1 8 LYS n 1 9 GLN n 1 10 ARG n 1 11 LEU n 1 12 ALA n 1 13 ALA n 1 14 ILE n 1 15 LYS n 1 16 THR n 1 17 ARG n 1 18 CYS n 1 19 GLN n 1 20 ALA n 1 21 LEU n 1 22 GLY n 1 23 GLY n 1 24 SER n 1 25 GLU n 1 26 ALA n 1 27 GLU n 1 28 CYS n 1 29 ALA n 1 30 ALA n 1 31 PHE n 1 32 GLU n 1 33 LYS n 1 34 GLU n 1 35 ILE n 1 36 ALA n 1 37 ALA n 1 38 PHE n 1 39 GLU n 1 40 SER n 1 41 GLU n 1 42 LEU n 1 43 GLN n 1 44 ALA n 1 45 TYR n 1 46 LYS n 1 47 GLY n 1 48 LYS n 1 49 GLY n 1 50 ASN n 1 51 PRO n 1 52 GLU n 1 53 VAL n 1 54 GLU n 1 55 ALA n 1 56 LEU n 1 57 ARG n 1 58 LYS n 1 59 GLU n 1 60 ALA n 1 61 ALA n 1 62 ALA n 1 63 ILE n 1 64 ARG n 1 65 ASP n 1 66 GLU n 1 67 CYS n 1 68 GLN n 1 69 ALA n 1 70 TYR n 1 71 ARG n 1 72 HIS n 1 73 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'BL21(DE3)' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 469008 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2MTQ _struct_ref.pdbx_db_accession 2MTQ _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code MGSWAEFKQRLAAIKTRCQALGGSEAECAAFEKEIAAFESELQAYKGKGNPEVEALRKEAAAIRDECQAYRHN _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MTQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2MTQ _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 73 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HNCA' 1 4 1 '3D HNCACB' 1 5 1 '3D HN(CO)CA' 1 6 1 '3D HNHA' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D HCCH-COSY' 1 9 1 '2D 1H-13C HSQC' 1 10 1 '3D 1H-15N NOESY' 2 11 2 '3D 1H-13C NOESY aliphatic' 2 12 2 '3D 1H-13C NOESY aromatic' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 100 7 ambient ? 298 K 2 100 7 ambient ? 298 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '100 mM sodium chloride, 0.5 % sodium azide, 0.05 mM PMSF, 0.8 mM TCEP, 1 mM [U-100% 13C; U-100% 15N] protein, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '100 mM sodium chloride, 0.5 % sodium azide, 0.05 mM PMSF, 0.8 mM TCEP, 1 mM [U-100% 13C; U-100% 15N] protein, 100% D2O' 2 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Agilent _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Agilent INOVA' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 1.94 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MTQ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 3.39 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.59 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method CYANA # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MTQ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 Goddard 'data analysis' Sparky ? 3 Goddard 'peak picking' Sparky ? 4 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS ? 5 ? refinement na ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MTQ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MTQ _struct.title 'Solution Structure of a De Novo Designed Peptide that Sequesters Toxic Heavy Metals' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MTQ _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'De Novo Protein Design, Triscysteine, Three-helix bundle, DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? LEU A 21 ? SER A 3 LEU A 21 1 ? 19 HELX_P HELX_P2 2 SER A 24 ? GLN A 43 ? SER A 24 GLN A 43 1 ? 20 HELX_P HELX_P3 3 ASN A 50 ? ARG A 71 ? ASN A 50 ARG A 71 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2MTQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 ASN 73 73 73 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-04-01 2 'Structure model' 1 1 2015-05-27 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0128 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.0014 _pdbx_nmr_ensemble_rms.entry_id 2MTQ _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium chloride-1' 100 ? mM ? 1 'sodium azide-2' 0.5 ? % ? 1 PMSF-3 0.05 ? mM ? 1 TCEP-4 0.8 ? mM ? 1 entity-5 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium chloride-6' 100 ? mM ? 2 'sodium azide-7' 0.5 ? % ? 2 PMSF-8 0.05 ? mM ? 2 TCEP-9 0.8 ? mM ? 2 entity-10 1 ? mM '[U-100% 13C; U-100% 15N]' 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MTQ _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 78 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total ? _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 17 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 60 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 61 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 21 ? ? 54.29 70.97 2 1 LYS A 46 ? ? -179.69 -62.53 3 1 HIS A 72 ? ? -176.84 33.31 4 2 SER A 24 ? ? -174.61 146.80 5 2 HIS A 72 ? ? -178.92 34.41 6 3 SER A 24 ? ? -179.54 140.78 7 3 LYS A 46 ? ? 179.05 -66.74 8 3 LYS A 48 ? ? -60.53 -74.94 9 3 ASN A 50 ? ? -119.93 77.54 10 3 HIS A 72 ? ? -179.82 34.76 11 4 SER A 24 ? ? 179.77 119.52 12 4 LYS A 46 ? ? -51.46 103.09 13 4 ASN A 50 ? ? 50.01 77.36 14 4 HIS A 72 ? ? -176.50 32.98 15 5 SER A 24 ? ? 179.61 121.76 16 5 ASN A 50 ? ? 179.46 59.41 17 5 HIS A 72 ? ? -176.79 33.11 18 6 HIS A 72 ? ? -176.16 32.56 19 7 LEU A 21 ? ? 53.53 70.36 20 7 HIS A 72 ? ? -94.78 34.37 21 8 SER A 24 ? ? -179.76 138.88 22 8 HIS A 72 ? ? -179.24 34.22 23 9 SER A 24 ? ? -179.65 137.06 24 9 LYS A 46 ? ? -161.29 -48.18 25 9 LYS A 48 ? ? 64.06 107.36 26 9 HIS A 72 ? ? -179.46 34.83 27 10 LYS A 46 ? ? 59.21 91.22 28 10 LYS A 48 ? ? 62.24 64.36 29 10 ASN A 50 ? ? 39.81 71.17 30 10 HIS A 72 ? ? -179.35 34.33 31 11 SER A 24 ? ? 179.75 120.41 32 11 ASN A 50 ? ? -113.31 75.42 33 11 HIS A 72 ? ? -94.06 32.84 34 12 LEU A 21 ? ? 56.42 77.26 35 12 LYS A 46 ? ? 50.15 83.38 36 12 LYS A 48 ? ? 51.33 70.61 37 12 ASN A 50 ? ? -171.20 76.68 38 12 HIS A 72 ? ? -176.63 33.02 39 13 LYS A 46 ? ? -179.68 -42.62 40 13 HIS A 72 ? ? -177.34 33.48 41 14 SER A 24 ? ? -179.97 134.98 42 14 LYS A 46 ? ? 63.07 64.44 43 14 ARG A 71 ? ? 176.89 -38.54 44 15 LEU A 21 ? ? 57.53 76.13 45 15 SER A 24 ? ? -164.60 114.40 46 15 LYS A 48 ? ? 50.80 87.75 47 15 ASN A 50 ? ? -111.76 78.98 48 15 HIS A 72 ? ? -179.68 33.85 49 16 SER A 24 ? ? -179.45 139.79 50 16 LYS A 46 ? ? -178.37 -74.97 51 16 ARG A 71 ? ? 178.75 54.58 52 16 HIS A 72 ? ? -179.90 41.50 53 17 LEU A 21 ? ? 54.84 72.83 54 17 SER A 24 ? ? -160.24 116.21 55 17 LYS A 46 ? ? -165.41 -46.53 56 17 LYS A 48 ? ? 70.70 -70.17 57 17 ASN A 50 ? ? -50.68 108.71 58 17 HIS A 72 ? ? -176.92 33.33 59 18 SER A 24 ? ? -179.82 141.64 60 18 LYS A 46 ? ? -173.60 -60.04 61 18 ASN A 50 ? ? -114.94 73.49 62 18 ARG A 71 ? ? -80.00 30.21 63 19 SER A 3 ? ? -98.67 30.34 64 19 HIS A 72 ? ? -177.13 33.12 65 20 SER A 24 ? ? -179.95 146.35 66 20 LYS A 46 ? ? -179.26 -58.71 67 20 LYS A 48 ? ? -51.86 -74.43 68 20 ASN A 50 ? ? -113.66 74.27 69 20 ARG A 71 ? ? -79.65 29.90 #