data_2MVT # _entry.id 2MVT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104106 RCSB ? ? 2MVT PDB pdb_00002mvt 10.2210/pdb2mvt/pdb 25283 BMRB ? 10.13018/BMR25283 D_1000104106 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-23 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_entry_details 8 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MVT _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-10-14 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 25283 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, F.' 1 'Sun, P.' 2 'Wang, C.' 3 'He, Y.' 4 'Zhang, L.' 5 'Tian, C.' 6 # _citation.id primary _citation.title 'A distinct three-helix centipede toxin SSD609 inhibits Iks channels by interacting with the KCNE1 auxiliary subunit.' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 5 _citation.page_first 13399 _citation.page_last 13399 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26307551 _citation.pdbx_database_id_DOI 10.1038/srep13399 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sun, P.' 1 ? primary 'Wu, F.' 2 ? primary 'Wen, M.' 3 ? primary 'Yang, X.' 4 ? primary 'Wang, C.' 5 ? primary 'Li, Y.' 6 ? primary 'He, S.' 7 ? primary 'Zhang, L.' 8 ? primary 'Zhang, Y.' 9 ? primary 'Tian, C.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Scoloptoxin SSD609' _entity.formula_weight 5640.350 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ADDKCEDSLRREIACTKCRDRVRTDDYFYECCTSESTFKKCQTMLHQ _entity_poly.pdbx_seq_one_letter_code_can ADDKCEDSLRREIACTKCRDRVRTDDYFYECCTSESTFKKCQTMLHQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 ASP n 1 4 LYS n 1 5 CYS n 1 6 GLU n 1 7 ASP n 1 8 SER n 1 9 LEU n 1 10 ARG n 1 11 ARG n 1 12 GLU n 1 13 ILE n 1 14 ALA n 1 15 CYS n 1 16 THR n 1 17 LYS n 1 18 CYS n 1 19 ARG n 1 20 ASP n 1 21 ARG n 1 22 VAL n 1 23 ARG n 1 24 THR n 1 25 ASP n 1 26 ASP n 1 27 TYR n 1 28 PHE n 1 29 TYR n 1 30 GLU n 1 31 CYS n 1 32 CYS n 1 33 THR n 1 34 SER n 1 35 GLU n 1 36 SER n 1 37 THR n 1 38 PHE n 1 39 LYS n 1 40 LYS n 1 41 CYS n 1 42 GLN n 1 43 THR n 1 44 MET n 1 45 LEU n 1 46 HIS n 1 47 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Scolopendra mutilans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 251420 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 GLN 47 47 47 GLN GLN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MVT _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MVT _struct.title 'Solution structure of scoloptoxin SSD609 from Scolopendra mutilans' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MVT _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2MVT _struct_ref.pdbx_db_accession 2MVT _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MVT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 47 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2MVT _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 47 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 47 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 8 ? VAL A 22 ? SER A 8 VAL A 22 1 ? 15 HELX_P HELX_P2 2 THR A 24 ? GLU A 30 ? THR A 24 GLU A 30 1 ? 7 HELX_P HELX_P3 3 GLU A 35 ? GLN A 47 ? GLU A 35 GLN A 47 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 5 A CYS 32 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 15 A CYS 31 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf3 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 18 A CYS 41 1_555 ? ? ? ? ? ? ? 2.020 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 5 ? CYS A 32 ? CYS A 5 ? 1_555 CYS A 32 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 15 ? CYS A 31 ? CYS A 15 ? 1_555 CYS A 31 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 18 ? CYS A 41 ? CYS A 18 ? 1_555 CYS A 41 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 2MVT _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H1 A ALA 1 ? ? H A ASP 2 ? ? 1.27 2 2 O A ARG 19 ? ? H A ARG 23 ? ? 1.59 3 2 O A THR 24 ? ? H A TYR 27 ? ? 1.59 4 3 O A ASP 2 ? ? H A LYS 4 ? ? 1.57 5 3 O A THR 24 ? ? H A TYR 27 ? ? 1.58 6 3 O A THR 16 ? ? H A ASP 20 ? ? 1.60 7 4 O A ARG 19 ? ? H A ARG 23 ? ? 1.60 8 5 O A CYS 5 ? ? H A SER 8 ? ? 1.56 9 5 O A ARG 19 ? ? H A ARG 23 ? ? 1.58 10 8 O A LYS 39 ? ? H A THR 43 ? ? 1.58 11 10 O A ASP 2 ? ? H A LYS 4 ? ? 1.58 12 12 O A THR 24 ? ? H A TYR 27 ? ? 1.57 13 13 O A THR 24 ? ? H A TYR 27 ? ? 1.58 14 13 O A GLU 12 ? ? HG1 A THR 16 ? ? 1.59 15 14 O A THR 43 ? ? H A GLN 47 ? ? 1.59 16 16 O A ARG 19 ? ? H A ARG 23 ? ? 1.58 17 17 O A THR 16 ? ? H A ASP 20 ? ? 1.56 18 17 O A ARG 11 ? ? H A CYS 15 ? ? 1.58 19 18 O A THR 16 ? ? H A ASP 20 ? ? 1.56 20 19 H1 A ALA 1 ? ? H A ASP 2 ? ? 1.26 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? 51.05 19.50 2 1 LYS A 4 ? ? -153.38 7.81 3 1 SER A 34 ? ? 51.19 170.69 4 2 ASP A 2 ? ? 32.47 36.29 5 2 LYS A 4 ? ? -156.75 8.63 6 2 CYS A 5 ? ? -133.80 -57.74 7 2 ARG A 23 ? ? 39.28 48.51 8 2 THR A 33 ? ? -69.97 -164.49 9 2 SER A 34 ? ? -36.98 142.70 10 2 HIS A 46 ? ? -101.19 -63.62 11 3 ASP A 3 ? ? -69.90 49.42 12 3 LYS A 4 ? ? 71.38 -0.30 13 3 THR A 33 ? ? -56.64 -146.90 14 4 ASP A 2 ? ? 30.93 38.72 15 4 LYS A 4 ? ? -169.56 -39.76 16 4 THR A 33 ? ? -145.87 -150.98 17 4 SER A 34 ? ? 32.20 93.73 18 5 ASP A 2 ? ? 36.57 21.48 19 5 LYS A 4 ? ? 55.93 2.71 20 5 CYS A 5 ? ? -111.34 -85.87 21 5 GLU A 6 ? ? -36.82 -26.14 22 5 ASP A 7 ? ? -58.59 -9.47 23 5 SER A 8 ? ? -159.14 86.91 24 5 LEU A 9 ? ? -42.54 -15.81 25 5 ASP A 25 ? ? -59.65 2.11 26 5 THR A 33 ? ? -75.48 -144.03 27 5 CYS A 41 ? ? -39.18 -36.73 28 5 HIS A 46 ? ? -179.10 65.75 29 6 ASP A 2 ? ? 33.85 35.95 30 6 LYS A 4 ? ? 59.94 -7.06 31 6 CYS A 5 ? ? -107.55 -70.33 32 6 ARG A 23 ? ? 28.49 56.82 33 6 ASP A 25 ? ? 68.21 -25.13 34 6 THR A 33 ? ? -73.88 -152.51 35 7 ASP A 2 ? ? 36.36 56.67 36 7 LYS A 4 ? ? -163.25 -25.21 37 7 ARG A 11 ? ? -62.96 7.10 38 7 THR A 33 ? ? -61.25 -169.52 39 7 SER A 34 ? ? -46.14 166.90 40 8 ASP A 3 ? ? -58.84 4.75 41 8 LYS A 4 ? ? 91.94 98.11 42 8 CYS A 5 ? ? 55.24 0.07 43 8 LEU A 9 ? ? -96.79 -61.84 44 8 ARG A 10 ? ? -52.84 -4.81 45 8 THR A 33 ? ? -82.99 -159.53 46 8 SER A 34 ? ? -46.17 -178.52 47 8 LYS A 40 ? ? -39.73 -21.08 48 8 HIS A 46 ? ? -167.59 55.35 49 9 ASP A 2 ? ? 31.30 33.65 50 9 ASP A 3 ? ? -28.88 -69.55 51 9 LYS A 4 ? ? -177.72 97.68 52 9 CYS A 5 ? ? 49.94 4.60 53 9 SER A 8 ? ? -67.32 83.57 54 9 LEU A 9 ? ? -59.72 4.52 55 9 THR A 33 ? ? -69.42 -153.55 56 10 ASP A 3 ? ? -68.87 56.85 57 10 LYS A 4 ? ? 68.16 -20.59 58 10 CYS A 5 ? ? -94.71 -79.22 59 10 LEU A 9 ? ? -62.99 0.88 60 10 ASP A 25 ? ? -56.09 0.59 61 10 CYS A 32 ? ? -58.33 -6.96 62 10 SER A 34 ? ? 50.49 96.92 63 11 CYS A 5 ? ? -103.47 -80.82 64 11 THR A 33 ? ? -59.27 -151.87 65 11 HIS A 46 ? ? -107.12 -73.07 66 12 ASP A 2 ? ? 25.40 38.52 67 12 LYS A 4 ? ? -157.36 -12.03 68 12 THR A 33 ? ? -151.25 -148.30 69 12 SER A 34 ? ? 42.10 103.77 70 12 HIS A 46 ? ? -163.03 74.46 71 13 ASP A 2 ? ? -168.31 -55.96 72 13 ASP A 3 ? ? 37.09 31.41 73 13 LYS A 4 ? ? 72.17 -30.66 74 13 CYS A 5 ? ? -91.92 -70.54 75 13 GLU A 6 ? ? -44.99 -16.51 76 13 LEU A 9 ? ? -54.20 -5.17 77 13 THR A 33 ? ? -68.61 -167.52 78 13 HIS A 46 ? ? -178.75 49.79 79 14 LYS A 4 ? ? -147.78 -37.85 80 14 ASP A 25 ? ? -57.15 2.95 81 14 THR A 33 ? ? -57.10 -165.14 82 14 SER A 34 ? ? -47.12 -173.32 83 15 LYS A 4 ? ? 68.34 -21.40 84 15 CYS A 5 ? ? -99.39 -82.88 85 15 GLU A 6 ? ? -36.20 -24.97 86 15 THR A 33 ? ? -134.97 -145.23 87 15 SER A 34 ? ? 37.49 88.90 88 15 HIS A 46 ? ? -90.81 -66.61 89 16 ASP A 2 ? ? 46.62 8.48 90 16 ASP A 3 ? ? -69.23 60.77 91 16 THR A 33 ? ? -64.40 -152.46 92 16 SER A 34 ? ? -66.10 -171.47 93 16 HIS A 46 ? ? -103.08 -63.78 94 17 ASP A 2 ? ? 47.98 23.34 95 17 LYS A 4 ? ? 84.33 -25.41 96 17 CYS A 32 ? ? -64.85 0.06 97 17 THR A 33 ? ? -67.94 -150.23 98 18 ASP A 2 ? ? 31.78 66.48 99 18 ASP A 3 ? ? -97.48 52.61 100 18 LYS A 4 ? ? 80.45 -14.07 101 18 CYS A 5 ? ? -105.02 -67.61 102 18 ASP A 25 ? ? -44.23 -15.69 103 18 THR A 33 ? ? -52.42 -164.29 104 18 SER A 34 ? ? -50.11 -173.69 105 18 LEU A 45 ? ? -36.30 -33.61 106 18 HIS A 46 ? ? -178.67 67.69 107 19 ASP A 2 ? ? 32.02 31.78 108 19 LYS A 4 ? ? -176.11 114.44 109 19 CYS A 5 ? ? 66.18 -30.62 110 19 CYS A 32 ? ? -62.27 2.91 111 19 THR A 33 ? ? -76.96 -153.08 112 19 SER A 34 ? ? -33.15 128.72 113 19 GLN A 42 ? ? -39.33 -38.47 114 20 LYS A 4 ? ? -149.73 -29.58 115 20 THR A 33 ? ? -54.19 -144.97 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MVT _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MVT _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1 mM SSD609, 50 mM TRIS, 100 mM sodium chloride, 5 mM calcium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id SSD609-1 1 ? mM ? 1 TRIS-2 50 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 'calcium chloride-4' 5 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.115 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D DQF-COSY' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MVT _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 715 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 158 _pdbx_nmr_constraints.NOE_long_range_total_count 49 _pdbx_nmr_constraints.NOE_medium_range_total_count 260 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 248 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2MVT _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 Goddard 'chemical shift assignment' Sparky ? 2 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PHE N N N N 220 PHE CA C N S 221 PHE C C N N 222 PHE O O N N 223 PHE CB C N N 224 PHE CG C Y N 225 PHE CD1 C Y N 226 PHE CD2 C Y N 227 PHE CE1 C Y N 228 PHE CE2 C Y N 229 PHE CZ C Y N 230 PHE OXT O N N 231 PHE H H N N 232 PHE H2 H N N 233 PHE HA H N N 234 PHE HB2 H N N 235 PHE HB3 H N N 236 PHE HD1 H N N 237 PHE HD2 H N N 238 PHE HE1 H N N 239 PHE HE2 H N N 240 PHE HZ H N N 241 PHE HXT H N N 242 SER N N N N 243 SER CA C N S 244 SER C C N N 245 SER O O N N 246 SER CB C N N 247 SER OG O N N 248 SER OXT O N N 249 SER H H N N 250 SER H2 H N N 251 SER HA H N N 252 SER HB2 H N N 253 SER HB3 H N N 254 SER HG H N N 255 SER HXT H N N 256 THR N N N N 257 THR CA C N S 258 THR C C N N 259 THR O O N N 260 THR CB C N R 261 THR OG1 O N N 262 THR CG2 C N N 263 THR OXT O N N 264 THR H H N N 265 THR H2 H N N 266 THR HA H N N 267 THR HB H N N 268 THR HG1 H N N 269 THR HG21 H N N 270 THR HG22 H N N 271 THR HG23 H N N 272 THR HXT H N N 273 TYR N N N N 274 TYR CA C N S 275 TYR C C N N 276 TYR O O N N 277 TYR CB C N N 278 TYR CG C Y N 279 TYR CD1 C Y N 280 TYR CD2 C Y N 281 TYR CE1 C Y N 282 TYR CE2 C Y N 283 TYR CZ C Y N 284 TYR OH O N N 285 TYR OXT O N N 286 TYR H H N N 287 TYR H2 H N N 288 TYR HA H N N 289 TYR HB2 H N N 290 TYR HB3 H N N 291 TYR HD1 H N N 292 TYR HD2 H N N 293 TYR HE1 H N N 294 TYR HE2 H N N 295 TYR HH H N N 296 TYR HXT H N N 297 VAL N N N N 298 VAL CA C N S 299 VAL C C N N 300 VAL O O N N 301 VAL CB C N N 302 VAL CG1 C N N 303 VAL CG2 C N N 304 VAL OXT O N N 305 VAL H H N N 306 VAL H2 H N N 307 VAL HA H N N 308 VAL HB H N N 309 VAL HG11 H N N 310 VAL HG12 H N N 311 VAL HG13 H N N 312 VAL HG21 H N N 313 VAL HG22 H N N 314 VAL HG23 H N N 315 VAL HXT H N N 316 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 HIS N CA sing N N 104 HIS N H sing N N 105 HIS N H2 sing N N 106 HIS CA C sing N N 107 HIS CA CB sing N N 108 HIS CA HA sing N N 109 HIS C O doub N N 110 HIS C OXT sing N N 111 HIS CB CG sing N N 112 HIS CB HB2 sing N N 113 HIS CB HB3 sing N N 114 HIS CG ND1 sing Y N 115 HIS CG CD2 doub Y N 116 HIS ND1 CE1 doub Y N 117 HIS ND1 HD1 sing N N 118 HIS CD2 NE2 sing Y N 119 HIS CD2 HD2 sing N N 120 HIS CE1 NE2 sing Y N 121 HIS CE1 HE1 sing N N 122 HIS NE2 HE2 sing N N 123 HIS OXT HXT sing N N 124 ILE N CA sing N N 125 ILE N H sing N N 126 ILE N H2 sing N N 127 ILE CA C sing N N 128 ILE CA CB sing N N 129 ILE CA HA sing N N 130 ILE C O doub N N 131 ILE C OXT sing N N 132 ILE CB CG1 sing N N 133 ILE CB CG2 sing N N 134 ILE CB HB sing N N 135 ILE CG1 CD1 sing N N 136 ILE CG1 HG12 sing N N 137 ILE CG1 HG13 sing N N 138 ILE CG2 HG21 sing N N 139 ILE CG2 HG22 sing N N 140 ILE CG2 HG23 sing N N 141 ILE CD1 HD11 sing N N 142 ILE CD1 HD12 sing N N 143 ILE CD1 HD13 sing N N 144 ILE OXT HXT sing N N 145 LEU N CA sing N N 146 LEU N H sing N N 147 LEU N H2 sing N N 148 LEU CA C sing N N 149 LEU CA CB sing N N 150 LEU CA HA sing N N 151 LEU C O doub N N 152 LEU C OXT sing N N 153 LEU CB CG sing N N 154 LEU CB HB2 sing N N 155 LEU CB HB3 sing N N 156 LEU CG CD1 sing N N 157 LEU CG CD2 sing N N 158 LEU CG HG sing N N 159 LEU CD1 HD11 sing N N 160 LEU CD1 HD12 sing N N 161 LEU CD1 HD13 sing N N 162 LEU CD2 HD21 sing N N 163 LEU CD2 HD22 sing N N 164 LEU CD2 HD23 sing N N 165 LEU OXT HXT sing N N 166 LYS N CA sing N N 167 LYS N H sing N N 168 LYS N H2 sing N N 169 LYS CA C sing N N 170 LYS CA CB sing N N 171 LYS CA HA sing N N 172 LYS C O doub N N 173 LYS C OXT sing N N 174 LYS CB CG sing N N 175 LYS CB HB2 sing N N 176 LYS CB HB3 sing N N 177 LYS CG CD sing N N 178 LYS CG HG2 sing N N 179 LYS CG HG3 sing N N 180 LYS CD CE sing N N 181 LYS CD HD2 sing N N 182 LYS CD HD3 sing N N 183 LYS CE NZ sing N N 184 LYS CE HE2 sing N N 185 LYS CE HE3 sing N N 186 LYS NZ HZ1 sing N N 187 LYS NZ HZ2 sing N N 188 LYS NZ HZ3 sing N N 189 LYS OXT HXT sing N N 190 MET N CA sing N N 191 MET N H sing N N 192 MET N H2 sing N N 193 MET CA C sing N N 194 MET CA CB sing N N 195 MET CA HA sing N N 196 MET C O doub N N 197 MET C OXT sing N N 198 MET CB CG sing N N 199 MET CB HB2 sing N N 200 MET CB HB3 sing N N 201 MET CG SD sing N N 202 MET CG HG2 sing N N 203 MET CG HG3 sing N N 204 MET SD CE sing N N 205 MET CE HE1 sing N N 206 MET CE HE2 sing N N 207 MET CE HE3 sing N N 208 MET OXT HXT sing N N 209 PHE N CA sing N N 210 PHE N H sing N N 211 PHE N H2 sing N N 212 PHE CA C sing N N 213 PHE CA CB sing N N 214 PHE CA HA sing N N 215 PHE C O doub N N 216 PHE C OXT sing N N 217 PHE CB CG sing N N 218 PHE CB HB2 sing N N 219 PHE CB HB3 sing N N 220 PHE CG CD1 doub Y N 221 PHE CG CD2 sing Y N 222 PHE CD1 CE1 sing Y N 223 PHE CD1 HD1 sing N N 224 PHE CD2 CE2 doub Y N 225 PHE CD2 HD2 sing N N 226 PHE CE1 CZ doub Y N 227 PHE CE1 HE1 sing N N 228 PHE CE2 CZ sing Y N 229 PHE CE2 HE2 sing N N 230 PHE CZ HZ sing N N 231 PHE OXT HXT sing N N 232 SER N CA sing N N 233 SER N H sing N N 234 SER N H2 sing N N 235 SER CA C sing N N 236 SER CA CB sing N N 237 SER CA HA sing N N 238 SER C O doub N N 239 SER C OXT sing N N 240 SER CB OG sing N N 241 SER CB HB2 sing N N 242 SER CB HB3 sing N N 243 SER OG HG sing N N 244 SER OXT HXT sing N N 245 THR N CA sing N N 246 THR N H sing N N 247 THR N H2 sing N N 248 THR CA C sing N N 249 THR CA CB sing N N 250 THR CA HA sing N N 251 THR C O doub N N 252 THR C OXT sing N N 253 THR CB OG1 sing N N 254 THR CB CG2 sing N N 255 THR CB HB sing N N 256 THR OG1 HG1 sing N N 257 THR CG2 HG21 sing N N 258 THR CG2 HG22 sing N N 259 THR CG2 HG23 sing N N 260 THR OXT HXT sing N N 261 TYR N CA sing N N 262 TYR N H sing N N 263 TYR N H2 sing N N 264 TYR CA C sing N N 265 TYR CA CB sing N N 266 TYR CA HA sing N N 267 TYR C O doub N N 268 TYR C OXT sing N N 269 TYR CB CG sing N N 270 TYR CB HB2 sing N N 271 TYR CB HB3 sing N N 272 TYR CG CD1 doub Y N 273 TYR CG CD2 sing Y N 274 TYR CD1 CE1 sing Y N 275 TYR CD1 HD1 sing N N 276 TYR CD2 CE2 doub Y N 277 TYR CD2 HD2 sing N N 278 TYR CE1 CZ doub Y N 279 TYR CE1 HE1 sing N N 280 TYR CE2 CZ sing Y N 281 TYR CE2 HE2 sing N N 282 TYR CZ OH sing N N 283 TYR OH HH sing N N 284 TYR OXT HXT sing N N 285 VAL N CA sing N N 286 VAL N H sing N N 287 VAL N H2 sing N N 288 VAL CA C sing N N 289 VAL CA CB sing N N 290 VAL CA HA sing N N 291 VAL C O doub N N 292 VAL C OXT sing N N 293 VAL CB CG1 sing N N 294 VAL CB CG2 sing N N 295 VAL CB HB sing N N 296 VAL CG1 HG11 sing N N 297 VAL CG1 HG12 sing N N 298 VAL CG1 HG13 sing N N 299 VAL CG2 HG21 sing N N 300 VAL CG2 HG22 sing N N 301 VAL CG2 HG23 sing N N 302 VAL OXT HXT sing N N 303 # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2MVT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_