data_2MVT
# 
_entry.id   2MVT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
RCSB104106   RCSB  ?            ?                   
2MVT         PDB   pdb_00002mvt 10.2210/pdb2mvt/pdb 
25283        BMRB  ?            10.13018/BMR25283   
D_1000104106 WWPDB ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-09-23 
2 'Structure model' 1 1 2023-06-14 
3 'Structure model' 1 2 2024-11-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 2 'Structure model' Other                 
4 3 'Structure model' 'Data collection'     
5 3 'Structure model' 'Database references' 
6 3 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' database_2                
2 2 'Structure model' pdbx_database_status      
3 2 'Structure model' pdbx_nmr_software         
4 3 'Structure model' chem_comp_atom            
5 3 'Structure model' chem_comp_bond            
6 3 'Structure model' database_2                
7 3 'Structure model' pdbx_entry_details        
8 3 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                       
2 2 'Structure model' '_database_2.pdbx_database_accession'        
3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
4 2 'Structure model' '_pdbx_nmr_software.name'                    
5 3 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2MVT 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-10-14 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
# 
_pdbx_database_related.db_id          25283 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, F.'    1 
'Sun, P.'   2 
'Wang, C.'  3 
'He, Y.'    4 
'Zhang, L.' 5 
'Tian, C.'  6 
# 
_citation.id                        primary 
_citation.title                     
'A distinct three-helix centipede toxin SSD609 inhibits Iks channels by interacting with the KCNE1 auxiliary subunit.' 
_citation.journal_abbrev            'Sci Rep' 
_citation.journal_volume            5 
_citation.page_first                13399 
_citation.page_last                 13399 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2045-2322 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26307551 
_citation.pdbx_database_id_DOI      10.1038/srep13399 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Sun, P.'   1  ? 
primary 'Wu, F.'    2  ? 
primary 'Wen, M.'   3  ? 
primary 'Yang, X.'  4  ? 
primary 'Wang, C.'  5  ? 
primary 'Li, Y.'    6  ? 
primary 'He, S.'    7  ? 
primary 'Zhang, L.' 8  ? 
primary 'Zhang, Y.' 9  ? 
primary 'Tian, C.'  10 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Scoloptoxin SSD609' 
_entity.formula_weight             5640.350 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ADDKCEDSLRREIACTKCRDRVRTDDYFYECCTSESTFKKCQTMLHQ 
_entity_poly.pdbx_seq_one_letter_code_can   ADDKCEDSLRREIACTKCRDRVRTDDYFYECCTSESTFKKCQTMLHQ 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  ASP n 
1 3  ASP n 
1 4  LYS n 
1 5  CYS n 
1 6  GLU n 
1 7  ASP n 
1 8  SER n 
1 9  LEU n 
1 10 ARG n 
1 11 ARG n 
1 12 GLU n 
1 13 ILE n 
1 14 ALA n 
1 15 CYS n 
1 16 THR n 
1 17 LYS n 
1 18 CYS n 
1 19 ARG n 
1 20 ASP n 
1 21 ARG n 
1 22 VAL n 
1 23 ARG n 
1 24 THR n 
1 25 ASP n 
1 26 ASP n 
1 27 TYR n 
1 28 PHE n 
1 29 TYR n 
1 30 GLU n 
1 31 CYS n 
1 32 CYS n 
1 33 THR n 
1 34 SER n 
1 35 GLU n 
1 36 SER n 
1 37 THR n 
1 38 PHE n 
1 39 LYS n 
1 40 LYS n 
1 41 CYS n 
1 42 GLN n 
1 43 THR n 
1 44 MET n 
1 45 LEU n 
1 46 HIS n 
1 47 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Scolopendra mutilans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     251420 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET28 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  ASP 2  2  2  ASP ASP A . n 
A 1 3  ASP 3  3  3  ASP ASP A . n 
A 1 4  LYS 4  4  4  LYS LYS A . n 
A 1 5  CYS 5  5  5  CYS CYS A . n 
A 1 6  GLU 6  6  6  GLU GLU A . n 
A 1 7  ASP 7  7  7  ASP ASP A . n 
A 1 8  SER 8  8  8  SER SER A . n 
A 1 9  LEU 9  9  9  LEU LEU A . n 
A 1 10 ARG 10 10 10 ARG ARG A . n 
A 1 11 ARG 11 11 11 ARG ARG A . n 
A 1 12 GLU 12 12 12 GLU GLU A . n 
A 1 13 ILE 13 13 13 ILE ILE A . n 
A 1 14 ALA 14 14 14 ALA ALA A . n 
A 1 15 CYS 15 15 15 CYS CYS A . n 
A 1 16 THR 16 16 16 THR THR A . n 
A 1 17 LYS 17 17 17 LYS LYS A . n 
A 1 18 CYS 18 18 18 CYS CYS A . n 
A 1 19 ARG 19 19 19 ARG ARG A . n 
A 1 20 ASP 20 20 20 ASP ASP A . n 
A 1 21 ARG 21 21 21 ARG ARG A . n 
A 1 22 VAL 22 22 22 VAL VAL A . n 
A 1 23 ARG 23 23 23 ARG ARG A . n 
A 1 24 THR 24 24 24 THR THR A . n 
A 1 25 ASP 25 25 25 ASP ASP A . n 
A 1 26 ASP 26 26 26 ASP ASP A . n 
A 1 27 TYR 27 27 27 TYR TYR A . n 
A 1 28 PHE 28 28 28 PHE PHE A . n 
A 1 29 TYR 29 29 29 TYR TYR A . n 
A 1 30 GLU 30 30 30 GLU GLU A . n 
A 1 31 CYS 31 31 31 CYS CYS A . n 
A 1 32 CYS 32 32 32 CYS CYS A . n 
A 1 33 THR 33 33 33 THR THR A . n 
A 1 34 SER 34 34 34 SER SER A . n 
A 1 35 GLU 35 35 35 GLU GLU A . n 
A 1 36 SER 36 36 36 SER SER A . n 
A 1 37 THR 37 37 37 THR THR A . n 
A 1 38 PHE 38 38 38 PHE PHE A . n 
A 1 39 LYS 39 39 39 LYS LYS A . n 
A 1 40 LYS 40 40 40 LYS LYS A . n 
A 1 41 CYS 41 41 41 CYS CYS A . n 
A 1 42 GLN 42 42 42 GLN GLN A . n 
A 1 43 THR 43 43 43 THR THR A . n 
A 1 44 MET 44 44 44 MET MET A . n 
A 1 45 LEU 45 45 45 LEU LEU A . n 
A 1 46 HIS 46 46 46 HIS HIS A . n 
A 1 47 GLN 47 47 47 GLN GLN A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2MVT 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2MVT 
_struct.title                     'Solution structure of scoloptoxin SSD609 from Scolopendra mutilans' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MVT 
_struct_keywords.pdbx_keywords   TOXIN 
_struct_keywords.text            TOXIN 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    2MVT 
_struct_ref.pdbx_db_accession          2MVT 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2MVT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 47 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             2MVT 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  47 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       47 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 8  ? VAL A 22 ? SER A 8  VAL A 22 1 ? 15 
HELX_P HELX_P2 2 THR A 24 ? GLU A 30 ? THR A 24 GLU A 30 1 ? 7  
HELX_P HELX_P3 3 GLU A 35 ? GLN A 47 ? GLU A 35 GLN A 47 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 5  SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 5  A CYS 32 1_555 ? ? ? ? ? ? ? 2.020 ? ? 
disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 15 A CYS 31 1_555 ? ? ? ? ? ? ? 2.020 ? ? 
disulf3 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 18 A CYS 41 1_555 ? ? ? ? ? ? ? 2.020 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CYS A 5  ? CYS A 32 ? CYS A 5  ? 1_555 CYS A 32 ? 1_555 SG SG . . . None 'Disulfide bridge' 
2 CYS A 15 ? CYS A 31 ? CYS A 15 ? 1_555 CYS A 31 ? 1_555 SG SG . . . None 'Disulfide bridge' 
3 CYS A 18 ? CYS A 41 ? CYS A 18 ? 1_555 CYS A 41 ? 1_555 SG SG . . . None 'Disulfide bridge' 
# 
_pdbx_entry_details.entry_id                   2MVT 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  H1 A ALA 1  ? ? H   A ASP 2  ? ? 1.27 
2  2  O  A ARG 19 ? ? H   A ARG 23 ? ? 1.59 
3  2  O  A THR 24 ? ? H   A TYR 27 ? ? 1.59 
4  3  O  A ASP 2  ? ? H   A LYS 4  ? ? 1.57 
5  3  O  A THR 24 ? ? H   A TYR 27 ? ? 1.58 
6  3  O  A THR 16 ? ? H   A ASP 20 ? ? 1.60 
7  4  O  A ARG 19 ? ? H   A ARG 23 ? ? 1.60 
8  5  O  A CYS 5  ? ? H   A SER 8  ? ? 1.56 
9  5  O  A ARG 19 ? ? H   A ARG 23 ? ? 1.58 
10 8  O  A LYS 39 ? ? H   A THR 43 ? ? 1.58 
11 10 O  A ASP 2  ? ? H   A LYS 4  ? ? 1.58 
12 12 O  A THR 24 ? ? H   A TYR 27 ? ? 1.57 
13 13 O  A THR 24 ? ? H   A TYR 27 ? ? 1.58 
14 13 O  A GLU 12 ? ? HG1 A THR 16 ? ? 1.59 
15 14 O  A THR 43 ? ? H   A GLN 47 ? ? 1.59 
16 16 O  A ARG 19 ? ? H   A ARG 23 ? ? 1.58 
17 17 O  A THR 16 ? ? H   A ASP 20 ? ? 1.56 
18 17 O  A ARG 11 ? ? H   A CYS 15 ? ? 1.58 
19 18 O  A THR 16 ? ? H   A ASP 20 ? ? 1.56 
20 19 H1 A ALA 1  ? ? H   A ASP 2  ? ? 1.26 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  ASP A 2  ? ? 51.05   19.50   
2   1  LYS A 4  ? ? -153.38 7.81    
3   1  SER A 34 ? ? 51.19   170.69  
4   2  ASP A 2  ? ? 32.47   36.29   
5   2  LYS A 4  ? ? -156.75 8.63    
6   2  CYS A 5  ? ? -133.80 -57.74  
7   2  ARG A 23 ? ? 39.28   48.51   
8   2  THR A 33 ? ? -69.97  -164.49 
9   2  SER A 34 ? ? -36.98  142.70  
10  2  HIS A 46 ? ? -101.19 -63.62  
11  3  ASP A 3  ? ? -69.90  49.42   
12  3  LYS A 4  ? ? 71.38   -0.30   
13  3  THR A 33 ? ? -56.64  -146.90 
14  4  ASP A 2  ? ? 30.93   38.72   
15  4  LYS A 4  ? ? -169.56 -39.76  
16  4  THR A 33 ? ? -145.87 -150.98 
17  4  SER A 34 ? ? 32.20   93.73   
18  5  ASP A 2  ? ? 36.57   21.48   
19  5  LYS A 4  ? ? 55.93   2.71    
20  5  CYS A 5  ? ? -111.34 -85.87  
21  5  GLU A 6  ? ? -36.82  -26.14  
22  5  ASP A 7  ? ? -58.59  -9.47   
23  5  SER A 8  ? ? -159.14 86.91   
24  5  LEU A 9  ? ? -42.54  -15.81  
25  5  ASP A 25 ? ? -59.65  2.11    
26  5  THR A 33 ? ? -75.48  -144.03 
27  5  CYS A 41 ? ? -39.18  -36.73  
28  5  HIS A 46 ? ? -179.10 65.75   
29  6  ASP A 2  ? ? 33.85   35.95   
30  6  LYS A 4  ? ? 59.94   -7.06   
31  6  CYS A 5  ? ? -107.55 -70.33  
32  6  ARG A 23 ? ? 28.49   56.82   
33  6  ASP A 25 ? ? 68.21   -25.13  
34  6  THR A 33 ? ? -73.88  -152.51 
35  7  ASP A 2  ? ? 36.36   56.67   
36  7  LYS A 4  ? ? -163.25 -25.21  
37  7  ARG A 11 ? ? -62.96  7.10    
38  7  THR A 33 ? ? -61.25  -169.52 
39  7  SER A 34 ? ? -46.14  166.90  
40  8  ASP A 3  ? ? -58.84  4.75    
41  8  LYS A 4  ? ? 91.94   98.11   
42  8  CYS A 5  ? ? 55.24   0.07    
43  8  LEU A 9  ? ? -96.79  -61.84  
44  8  ARG A 10 ? ? -52.84  -4.81   
45  8  THR A 33 ? ? -82.99  -159.53 
46  8  SER A 34 ? ? -46.17  -178.52 
47  8  LYS A 40 ? ? -39.73  -21.08  
48  8  HIS A 46 ? ? -167.59 55.35   
49  9  ASP A 2  ? ? 31.30   33.65   
50  9  ASP A 3  ? ? -28.88  -69.55  
51  9  LYS A 4  ? ? -177.72 97.68   
52  9  CYS A 5  ? ? 49.94   4.60    
53  9  SER A 8  ? ? -67.32  83.57   
54  9  LEU A 9  ? ? -59.72  4.52    
55  9  THR A 33 ? ? -69.42  -153.55 
56  10 ASP A 3  ? ? -68.87  56.85   
57  10 LYS A 4  ? ? 68.16   -20.59  
58  10 CYS A 5  ? ? -94.71  -79.22  
59  10 LEU A 9  ? ? -62.99  0.88    
60  10 ASP A 25 ? ? -56.09  0.59    
61  10 CYS A 32 ? ? -58.33  -6.96   
62  10 SER A 34 ? ? 50.49   96.92   
63  11 CYS A 5  ? ? -103.47 -80.82  
64  11 THR A 33 ? ? -59.27  -151.87 
65  11 HIS A 46 ? ? -107.12 -73.07  
66  12 ASP A 2  ? ? 25.40   38.52   
67  12 LYS A 4  ? ? -157.36 -12.03  
68  12 THR A 33 ? ? -151.25 -148.30 
69  12 SER A 34 ? ? 42.10   103.77  
70  12 HIS A 46 ? ? -163.03 74.46   
71  13 ASP A 2  ? ? -168.31 -55.96  
72  13 ASP A 3  ? ? 37.09   31.41   
73  13 LYS A 4  ? ? 72.17   -30.66  
74  13 CYS A 5  ? ? -91.92  -70.54  
75  13 GLU A 6  ? ? -44.99  -16.51  
76  13 LEU A 9  ? ? -54.20  -5.17   
77  13 THR A 33 ? ? -68.61  -167.52 
78  13 HIS A 46 ? ? -178.75 49.79   
79  14 LYS A 4  ? ? -147.78 -37.85  
80  14 ASP A 25 ? ? -57.15  2.95    
81  14 THR A 33 ? ? -57.10  -165.14 
82  14 SER A 34 ? ? -47.12  -173.32 
83  15 LYS A 4  ? ? 68.34   -21.40  
84  15 CYS A 5  ? ? -99.39  -82.88  
85  15 GLU A 6  ? ? -36.20  -24.97  
86  15 THR A 33 ? ? -134.97 -145.23 
87  15 SER A 34 ? ? 37.49   88.90   
88  15 HIS A 46 ? ? -90.81  -66.61  
89  16 ASP A 2  ? ? 46.62   8.48    
90  16 ASP A 3  ? ? -69.23  60.77   
91  16 THR A 33 ? ? -64.40  -152.46 
92  16 SER A 34 ? ? -66.10  -171.47 
93  16 HIS A 46 ? ? -103.08 -63.78  
94  17 ASP A 2  ? ? 47.98   23.34   
95  17 LYS A 4  ? ? 84.33   -25.41  
96  17 CYS A 32 ? ? -64.85  0.06    
97  17 THR A 33 ? ? -67.94  -150.23 
98  18 ASP A 2  ? ? 31.78   66.48   
99  18 ASP A 3  ? ? -97.48  52.61   
100 18 LYS A 4  ? ? 80.45   -14.07  
101 18 CYS A 5  ? ? -105.02 -67.61  
102 18 ASP A 25 ? ? -44.23  -15.69  
103 18 THR A 33 ? ? -52.42  -164.29 
104 18 SER A 34 ? ? -50.11  -173.69 
105 18 LEU A 45 ? ? -36.30  -33.61  
106 18 HIS A 46 ? ? -178.67 67.69   
107 19 ASP A 2  ? ? 32.02   31.78   
108 19 LYS A 4  ? ? -176.11 114.44  
109 19 CYS A 5  ? ? 66.18   -30.62  
110 19 CYS A 32 ? ? -62.27  2.91    
111 19 THR A 33 ? ? -76.96  -153.08 
112 19 SER A 34 ? ? -33.15  128.72  
113 19 GLN A 42 ? ? -39.33  -38.47  
114 20 LYS A 4  ? ? -149.73 -29.58  
115 20 THR A 33 ? ? -54.19  -144.97 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2MVT 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2MVT 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.contents         '1 mM SSD609, 50 mM TRIS, 100 mM sodium chloride, 5 mM calcium chloride, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
SSD609-1             1   ? mM ? 1 
TRIS-2               50  ? mM ? 1 
'sodium chloride-3'  100 ? mM ? 1 
'calcium chloride-4' 5   ? mM ? 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.115 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D DQF-COSY'    
1 2 1 '2D 1H-1H TOCSY' 
1 3 1 '2D 1H-1H NOESY' 
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        ? 
_pdbx_nmr_constraints.entry_id                                      2MVT 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         715 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  158 
_pdbx_nmr_constraints.NOE_long_range_total_count                    49 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  260 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    248 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   ? 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     ? 
# 
_pdbx_nmr_refine.entry_id           2MVT 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe      ? 1 
Goddard                                             'chemical shift assignment' Sparky       ? 2 
'Schwieters, Kuszewski, Tjandra and Clore'          'structure solution'        'X-PLOR NIH' ? 3 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  'X-PLOR NIH' ? 4 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASP N    N N N 41  
ASP CA   C N S 42  
ASP C    C N N 43  
ASP O    O N N 44  
ASP CB   C N N 45  
ASP CG   C N N 46  
ASP OD1  O N N 47  
ASP OD2  O N N 48  
ASP OXT  O N N 49  
ASP H    H N N 50  
ASP H2   H N N 51  
ASP HA   H N N 52  
ASP HB2  H N N 53  
ASP HB3  H N N 54  
ASP HD2  H N N 55  
ASP HXT  H N N 56  
CYS N    N N N 57  
CYS CA   C N R 58  
CYS C    C N N 59  
CYS O    O N N 60  
CYS CB   C N N 61  
CYS SG   S N N 62  
CYS OXT  O N N 63  
CYS H    H N N 64  
CYS H2   H N N 65  
CYS HA   H N N 66  
CYS HB2  H N N 67  
CYS HB3  H N N 68  
CYS HG   H N N 69  
CYS HXT  H N N 70  
GLN N    N N N 71  
GLN CA   C N S 72  
GLN C    C N N 73  
GLN O    O N N 74  
GLN CB   C N N 75  
GLN CG   C N N 76  
GLN CD   C N N 77  
GLN OE1  O N N 78  
GLN NE2  N N N 79  
GLN OXT  O N N 80  
GLN H    H N N 81  
GLN H2   H N N 82  
GLN HA   H N N 83  
GLN HB2  H N N 84  
GLN HB3  H N N 85  
GLN HG2  H N N 86  
GLN HG3  H N N 87  
GLN HE21 H N N 88  
GLN HE22 H N N 89  
GLN HXT  H N N 90  
GLU N    N N N 91  
GLU CA   C N S 92  
GLU C    C N N 93  
GLU O    O N N 94  
GLU CB   C N N 95  
GLU CG   C N N 96  
GLU CD   C N N 97  
GLU OE1  O N N 98  
GLU OE2  O N N 99  
GLU OXT  O N N 100 
GLU H    H N N 101 
GLU H2   H N N 102 
GLU HA   H N N 103 
GLU HB2  H N N 104 
GLU HB3  H N N 105 
GLU HG2  H N N 106 
GLU HG3  H N N 107 
GLU HE2  H N N 108 
GLU HXT  H N N 109 
HIS N    N N N 110 
HIS CA   C N S 111 
HIS C    C N N 112 
HIS O    O N N 113 
HIS CB   C N N 114 
HIS CG   C Y N 115 
HIS ND1  N Y N 116 
HIS CD2  C Y N 117 
HIS CE1  C Y N 118 
HIS NE2  N Y N 119 
HIS OXT  O N N 120 
HIS H    H N N 121 
HIS H2   H N N 122 
HIS HA   H N N 123 
HIS HB2  H N N 124 
HIS HB3  H N N 125 
HIS HD1  H N N 126 
HIS HD2  H N N 127 
HIS HE1  H N N 128 
HIS HE2  H N N 129 
HIS HXT  H N N 130 
ILE N    N N N 131 
ILE CA   C N S 132 
ILE C    C N N 133 
ILE O    O N N 134 
ILE CB   C N S 135 
ILE CG1  C N N 136 
ILE CG2  C N N 137 
ILE CD1  C N N 138 
ILE OXT  O N N 139 
ILE H    H N N 140 
ILE H2   H N N 141 
ILE HA   H N N 142 
ILE HB   H N N 143 
ILE HG12 H N N 144 
ILE HG13 H N N 145 
ILE HG21 H N N 146 
ILE HG22 H N N 147 
ILE HG23 H N N 148 
ILE HD11 H N N 149 
ILE HD12 H N N 150 
ILE HD13 H N N 151 
ILE HXT  H N N 152 
LEU N    N N N 153 
LEU CA   C N S 154 
LEU C    C N N 155 
LEU O    O N N 156 
LEU CB   C N N 157 
LEU CG   C N N 158 
LEU CD1  C N N 159 
LEU CD2  C N N 160 
LEU OXT  O N N 161 
LEU H    H N N 162 
LEU H2   H N N 163 
LEU HA   H N N 164 
LEU HB2  H N N 165 
LEU HB3  H N N 166 
LEU HG   H N N 167 
LEU HD11 H N N 168 
LEU HD12 H N N 169 
LEU HD13 H N N 170 
LEU HD21 H N N 171 
LEU HD22 H N N 172 
LEU HD23 H N N 173 
LEU HXT  H N N 174 
LYS N    N N N 175 
LYS CA   C N S 176 
LYS C    C N N 177 
LYS O    O N N 178 
LYS CB   C N N 179 
LYS CG   C N N 180 
LYS CD   C N N 181 
LYS CE   C N N 182 
LYS NZ   N N N 183 
LYS OXT  O N N 184 
LYS H    H N N 185 
LYS H2   H N N 186 
LYS HA   H N N 187 
LYS HB2  H N N 188 
LYS HB3  H N N 189 
LYS HG2  H N N 190 
LYS HG3  H N N 191 
LYS HD2  H N N 192 
LYS HD3  H N N 193 
LYS HE2  H N N 194 
LYS HE3  H N N 195 
LYS HZ1  H N N 196 
LYS HZ2  H N N 197 
LYS HZ3  H N N 198 
LYS HXT  H N N 199 
MET N    N N N 200 
MET CA   C N S 201 
MET C    C N N 202 
MET O    O N N 203 
MET CB   C N N 204 
MET CG   C N N 205 
MET SD   S N N 206 
MET CE   C N N 207 
MET OXT  O N N 208 
MET H    H N N 209 
MET H2   H N N 210 
MET HA   H N N 211 
MET HB2  H N N 212 
MET HB3  H N N 213 
MET HG2  H N N 214 
MET HG3  H N N 215 
MET HE1  H N N 216 
MET HE2  H N N 217 
MET HE3  H N N 218 
MET HXT  H N N 219 
PHE N    N N N 220 
PHE CA   C N S 221 
PHE C    C N N 222 
PHE O    O N N 223 
PHE CB   C N N 224 
PHE CG   C Y N 225 
PHE CD1  C Y N 226 
PHE CD2  C Y N 227 
PHE CE1  C Y N 228 
PHE CE2  C Y N 229 
PHE CZ   C Y N 230 
PHE OXT  O N N 231 
PHE H    H N N 232 
PHE H2   H N N 233 
PHE HA   H N N 234 
PHE HB2  H N N 235 
PHE HB3  H N N 236 
PHE HD1  H N N 237 
PHE HD2  H N N 238 
PHE HE1  H N N 239 
PHE HE2  H N N 240 
PHE HZ   H N N 241 
PHE HXT  H N N 242 
SER N    N N N 243 
SER CA   C N S 244 
SER C    C N N 245 
SER O    O N N 246 
SER CB   C N N 247 
SER OG   O N N 248 
SER OXT  O N N 249 
SER H    H N N 250 
SER H2   H N N 251 
SER HA   H N N 252 
SER HB2  H N N 253 
SER HB3  H N N 254 
SER HG   H N N 255 
SER HXT  H N N 256 
THR N    N N N 257 
THR CA   C N S 258 
THR C    C N N 259 
THR O    O N N 260 
THR CB   C N R 261 
THR OG1  O N N 262 
THR CG2  C N N 263 
THR OXT  O N N 264 
THR H    H N N 265 
THR H2   H N N 266 
THR HA   H N N 267 
THR HB   H N N 268 
THR HG1  H N N 269 
THR HG21 H N N 270 
THR HG22 H N N 271 
THR HG23 H N N 272 
THR HXT  H N N 273 
TYR N    N N N 274 
TYR CA   C N S 275 
TYR C    C N N 276 
TYR O    O N N 277 
TYR CB   C N N 278 
TYR CG   C Y N 279 
TYR CD1  C Y N 280 
TYR CD2  C Y N 281 
TYR CE1  C Y N 282 
TYR CE2  C Y N 283 
TYR CZ   C Y N 284 
TYR OH   O N N 285 
TYR OXT  O N N 286 
TYR H    H N N 287 
TYR H2   H N N 288 
TYR HA   H N N 289 
TYR HB2  H N N 290 
TYR HB3  H N N 291 
TYR HD1  H N N 292 
TYR HD2  H N N 293 
TYR HE1  H N N 294 
TYR HE2  H N N 295 
TYR HH   H N N 296 
TYR HXT  H N N 297 
VAL N    N N N 298 
VAL CA   C N S 299 
VAL C    C N N 300 
VAL O    O N N 301 
VAL CB   C N N 302 
VAL CG1  C N N 303 
VAL CG2  C N N 304 
VAL OXT  O N N 305 
VAL H    H N N 306 
VAL H2   H N N 307 
VAL HA   H N N 308 
VAL HB   H N N 309 
VAL HG11 H N N 310 
VAL HG12 H N N 311 
VAL HG13 H N N 312 
VAL HG21 H N N 313 
VAL HG22 H N N 314 
VAL HG23 H N N 315 
VAL HXT  H N N 316 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASP N   CA   sing N N 39  
ASP N   H    sing N N 40  
ASP N   H2   sing N N 41  
ASP CA  C    sing N N 42  
ASP CA  CB   sing N N 43  
ASP CA  HA   sing N N 44  
ASP C   O    doub N N 45  
ASP C   OXT  sing N N 46  
ASP CB  CG   sing N N 47  
ASP CB  HB2  sing N N 48  
ASP CB  HB3  sing N N 49  
ASP CG  OD1  doub N N 50  
ASP CG  OD2  sing N N 51  
ASP OD2 HD2  sing N N 52  
ASP OXT HXT  sing N N 53  
CYS N   CA   sing N N 54  
CYS N   H    sing N N 55  
CYS N   H2   sing N N 56  
CYS CA  C    sing N N 57  
CYS CA  CB   sing N N 58  
CYS CA  HA   sing N N 59  
CYS C   O    doub N N 60  
CYS C   OXT  sing N N 61  
CYS CB  SG   sing N N 62  
CYS CB  HB2  sing N N 63  
CYS CB  HB3  sing N N 64  
CYS SG  HG   sing N N 65  
CYS OXT HXT  sing N N 66  
GLN N   CA   sing N N 67  
GLN N   H    sing N N 68  
GLN N   H2   sing N N 69  
GLN CA  C    sing N N 70  
GLN CA  CB   sing N N 71  
GLN CA  HA   sing N N 72  
GLN C   O    doub N N 73  
GLN C   OXT  sing N N 74  
GLN CB  CG   sing N N 75  
GLN CB  HB2  sing N N 76  
GLN CB  HB3  sing N N 77  
GLN CG  CD   sing N N 78  
GLN CG  HG2  sing N N 79  
GLN CG  HG3  sing N N 80  
GLN CD  OE1  doub N N 81  
GLN CD  NE2  sing N N 82  
GLN NE2 HE21 sing N N 83  
GLN NE2 HE22 sing N N 84  
GLN OXT HXT  sing N N 85  
GLU N   CA   sing N N 86  
GLU N   H    sing N N 87  
GLU N   H2   sing N N 88  
GLU CA  C    sing N N 89  
GLU CA  CB   sing N N 90  
GLU CA  HA   sing N N 91  
GLU C   O    doub N N 92  
GLU C   OXT  sing N N 93  
GLU CB  CG   sing N N 94  
GLU CB  HB2  sing N N 95  
GLU CB  HB3  sing N N 96  
GLU CG  CD   sing N N 97  
GLU CG  HG2  sing N N 98  
GLU CG  HG3  sing N N 99  
GLU CD  OE1  doub N N 100 
GLU CD  OE2  sing N N 101 
GLU OE2 HE2  sing N N 102 
GLU OXT HXT  sing N N 103 
HIS N   CA   sing N N 104 
HIS N   H    sing N N 105 
HIS N   H2   sing N N 106 
HIS CA  C    sing N N 107 
HIS CA  CB   sing N N 108 
HIS CA  HA   sing N N 109 
HIS C   O    doub N N 110 
HIS C   OXT  sing N N 111 
HIS CB  CG   sing N N 112 
HIS CB  HB2  sing N N 113 
HIS CB  HB3  sing N N 114 
HIS CG  ND1  sing Y N 115 
HIS CG  CD2  doub Y N 116 
HIS ND1 CE1  doub Y N 117 
HIS ND1 HD1  sing N N 118 
HIS CD2 NE2  sing Y N 119 
HIS CD2 HD2  sing N N 120 
HIS CE1 NE2  sing Y N 121 
HIS CE1 HE1  sing N N 122 
HIS NE2 HE2  sing N N 123 
HIS OXT HXT  sing N N 124 
ILE N   CA   sing N N 125 
ILE N   H    sing N N 126 
ILE N   H2   sing N N 127 
ILE CA  C    sing N N 128 
ILE CA  CB   sing N N 129 
ILE CA  HA   sing N N 130 
ILE C   O    doub N N 131 
ILE C   OXT  sing N N 132 
ILE CB  CG1  sing N N 133 
ILE CB  CG2  sing N N 134 
ILE CB  HB   sing N N 135 
ILE CG1 CD1  sing N N 136 
ILE CG1 HG12 sing N N 137 
ILE CG1 HG13 sing N N 138 
ILE CG2 HG21 sing N N 139 
ILE CG2 HG22 sing N N 140 
ILE CG2 HG23 sing N N 141 
ILE CD1 HD11 sing N N 142 
ILE CD1 HD12 sing N N 143 
ILE CD1 HD13 sing N N 144 
ILE OXT HXT  sing N N 145 
LEU N   CA   sing N N 146 
LEU N   H    sing N N 147 
LEU N   H2   sing N N 148 
LEU CA  C    sing N N 149 
LEU CA  CB   sing N N 150 
LEU CA  HA   sing N N 151 
LEU C   O    doub N N 152 
LEU C   OXT  sing N N 153 
LEU CB  CG   sing N N 154 
LEU CB  HB2  sing N N 155 
LEU CB  HB3  sing N N 156 
LEU CG  CD1  sing N N 157 
LEU CG  CD2  sing N N 158 
LEU CG  HG   sing N N 159 
LEU CD1 HD11 sing N N 160 
LEU CD1 HD12 sing N N 161 
LEU CD1 HD13 sing N N 162 
LEU CD2 HD21 sing N N 163 
LEU CD2 HD22 sing N N 164 
LEU CD2 HD23 sing N N 165 
LEU OXT HXT  sing N N 166 
LYS N   CA   sing N N 167 
LYS N   H    sing N N 168 
LYS N   H2   sing N N 169 
LYS CA  C    sing N N 170 
LYS CA  CB   sing N N 171 
LYS CA  HA   sing N N 172 
LYS C   O    doub N N 173 
LYS C   OXT  sing N N 174 
LYS CB  CG   sing N N 175 
LYS CB  HB2  sing N N 176 
LYS CB  HB3  sing N N 177 
LYS CG  CD   sing N N 178 
LYS CG  HG2  sing N N 179 
LYS CG  HG3  sing N N 180 
LYS CD  CE   sing N N 181 
LYS CD  HD2  sing N N 182 
LYS CD  HD3  sing N N 183 
LYS CE  NZ   sing N N 184 
LYS CE  HE2  sing N N 185 
LYS CE  HE3  sing N N 186 
LYS NZ  HZ1  sing N N 187 
LYS NZ  HZ2  sing N N 188 
LYS NZ  HZ3  sing N N 189 
LYS OXT HXT  sing N N 190 
MET N   CA   sing N N 191 
MET N   H    sing N N 192 
MET N   H2   sing N N 193 
MET CA  C    sing N N 194 
MET CA  CB   sing N N 195 
MET CA  HA   sing N N 196 
MET C   O    doub N N 197 
MET C   OXT  sing N N 198 
MET CB  CG   sing N N 199 
MET CB  HB2  sing N N 200 
MET CB  HB3  sing N N 201 
MET CG  SD   sing N N 202 
MET CG  HG2  sing N N 203 
MET CG  HG3  sing N N 204 
MET SD  CE   sing N N 205 
MET CE  HE1  sing N N 206 
MET CE  HE2  sing N N 207 
MET CE  HE3  sing N N 208 
MET OXT HXT  sing N N 209 
PHE N   CA   sing N N 210 
PHE N   H    sing N N 211 
PHE N   H2   sing N N 212 
PHE CA  C    sing N N 213 
PHE CA  CB   sing N N 214 
PHE CA  HA   sing N N 215 
PHE C   O    doub N N 216 
PHE C   OXT  sing N N 217 
PHE CB  CG   sing N N 218 
PHE CB  HB2  sing N N 219 
PHE CB  HB3  sing N N 220 
PHE CG  CD1  doub Y N 221 
PHE CG  CD2  sing Y N 222 
PHE CD1 CE1  sing Y N 223 
PHE CD1 HD1  sing N N 224 
PHE CD2 CE2  doub Y N 225 
PHE CD2 HD2  sing N N 226 
PHE CE1 CZ   doub Y N 227 
PHE CE1 HE1  sing N N 228 
PHE CE2 CZ   sing Y N 229 
PHE CE2 HE2  sing N N 230 
PHE CZ  HZ   sing N N 231 
PHE OXT HXT  sing N N 232 
SER N   CA   sing N N 233 
SER N   H    sing N N 234 
SER N   H2   sing N N 235 
SER CA  C    sing N N 236 
SER CA  CB   sing N N 237 
SER CA  HA   sing N N 238 
SER C   O    doub N N 239 
SER C   OXT  sing N N 240 
SER CB  OG   sing N N 241 
SER CB  HB2  sing N N 242 
SER CB  HB3  sing N N 243 
SER OG  HG   sing N N 244 
SER OXT HXT  sing N N 245 
THR N   CA   sing N N 246 
THR N   H    sing N N 247 
THR N   H2   sing N N 248 
THR CA  C    sing N N 249 
THR CA  CB   sing N N 250 
THR CA  HA   sing N N 251 
THR C   O    doub N N 252 
THR C   OXT  sing N N 253 
THR CB  OG1  sing N N 254 
THR CB  CG2  sing N N 255 
THR CB  HB   sing N N 256 
THR OG1 HG1  sing N N 257 
THR CG2 HG21 sing N N 258 
THR CG2 HG22 sing N N 259 
THR CG2 HG23 sing N N 260 
THR OXT HXT  sing N N 261 
TYR N   CA   sing N N 262 
TYR N   H    sing N N 263 
TYR N   H2   sing N N 264 
TYR CA  C    sing N N 265 
TYR CA  CB   sing N N 266 
TYR CA  HA   sing N N 267 
TYR C   O    doub N N 268 
TYR C   OXT  sing N N 269 
TYR CB  CG   sing N N 270 
TYR CB  HB2  sing N N 271 
TYR CB  HB3  sing N N 272 
TYR CG  CD1  doub Y N 273 
TYR CG  CD2  sing Y N 274 
TYR CD1 CE1  sing Y N 275 
TYR CD1 HD1  sing N N 276 
TYR CD2 CE2  doub Y N 277 
TYR CD2 HD2  sing N N 278 
TYR CE1 CZ   doub Y N 279 
TYR CE1 HE1  sing N N 280 
TYR CE2 CZ   sing Y N 281 
TYR CE2 HE2  sing N N 282 
TYR CZ  OH   sing N N 283 
TYR OH  HH   sing N N 284 
TYR OXT HXT  sing N N 285 
VAL N   CA   sing N N 286 
VAL N   H    sing N N 287 
VAL N   H2   sing N N 288 
VAL CA  C    sing N N 289 
VAL CA  CB   sing N N 290 
VAL CA  HA   sing N N 291 
VAL C   O    doub N N 292 
VAL C   OXT  sing N N 293 
VAL CB  CG1  sing N N 294 
VAL CB  CG2  sing N N 295 
VAL CB  HB   sing N N 296 
VAL CG1 HG11 sing N N 297 
VAL CG1 HG12 sing N N 298 
VAL CG1 HG13 sing N N 299 
VAL CG2 HG21 sing N N 300 
VAL CG2 HG22 sing N N 301 
VAL CG2 HG23 sing N N 302 
VAL OXT HXT  sing N N 303 
# 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Varian INOVA' 
# 
_atom_sites.entry_id                    2MVT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_