data_2MWT # _entry.id 2MWT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104142 RCSB ? ? 2MWT PDB pdb_00002mwt 10.2210/pdb2mwt/pdb 25363 BMRB ? 10.13018/BMR25363 D_1000104142 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-11-04 2 'Structure model' 1 1 2015-12-09 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MWT _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-11-24 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 25363 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jimenez, M.' 1 'Zamora-Carreras, H.' 2 # _citation.id primary _citation.title ;Structural Dissection of Crotalicidin, a Rattlesnake Venom Cathelicidin, Retrieves a Fragment with Antimicrobial and Antitumor Activity. ; _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 58 _citation.page_first 8553 _citation.page_last 8563 _citation.year 2015 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26465972 _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.5b01142 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Falcao, C.B.' 1 ? primary 'Perez-Peinado, C.' 2 ? primary 'de la Torre, B.G.' 3 ? primary 'Mayol, X.' 4 ? primary 'Zamora-Carreras, H.' 5 ? primary 'Jimenez, M.A.' 6 ? primary 'Radis-Baptista, G.' 7 ? primary 'Andreu, D.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Cathelicidin-like peptide' _entity.formula_weight 4167.423 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 161-194' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF _entity_poly.pdbx_seq_one_letter_code_can KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 ARG n 1 3 PHE n 1 4 LYS n 1 5 LYS n 1 6 PHE n 1 7 PHE n 1 8 LYS n 1 9 LYS n 1 10 VAL n 1 11 LYS n 1 12 LYS n 1 13 SER n 1 14 VAL n 1 15 LYS n 1 16 LYS n 1 17 ARG n 1 18 LEU n 1 19 LYS n 1 20 LYS n 1 21 ILE n 1 22 PHE n 1 23 LYS n 1 24 LYS n 1 25 PRO n 1 26 MET n 1 27 VAL n 1 28 ILE n 1 29 GLY n 1 30 VAL n 1 31 THR n 1 32 ILE n 1 33 PRO n 1 34 PHE n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Crotalus durissus terrificus' _pdbx_entity_src_syn.organism_common_name 'South American rattlesnake,cascabel' _pdbx_entity_src_syn.ncbi_taxonomy_id 8732 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 PHE 34 34 34 PHE PHE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MWT _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MWT _struct.title 'NMR structure of crotalicidin in DPC micelles' _struct.pdbx_model_details 'fewest violations, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MWT _struct_keywords.pdbx_keywords 'antimicrobial, antitumor protein' _struct_keywords.text 'antimicrobial peptide, antitumor peptide, antimicrobial protein, antitumor protein, antimicrobial' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code U5KJM4_CRODU _struct_ref.pdbx_db_accession U5KJM4 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 161 _struct_ref.pdbx_seq_one_letter_code KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MWT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession U5KJM4 _struct_ref_seq.db_align_beg 161 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 194 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 2 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 22 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 2 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 22 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 22 ? ? -99.30 38.93 2 2 PHE A 22 ? ? -97.31 39.66 3 2 MET A 26 ? ? -67.16 -70.68 4 2 VAL A 27 ? ? -171.91 145.94 5 4 PHE A 22 ? ? -98.00 31.09 6 4 PRO A 33 ? ? -69.78 99.48 7 5 PHE A 22 ? ? -98.87 40.09 8 5 PRO A 25 ? ? -69.69 99.14 9 5 PRO A 33 ? ? -69.73 81.84 10 6 PRO A 33 ? ? -69.82 90.30 11 8 PRO A 33 ? ? -69.72 95.87 12 9 MET A 26 ? ? -71.85 -73.96 13 9 VAL A 27 ? ? -175.64 136.62 14 10 PHE A 22 ? ? -97.05 38.25 15 12 PRO A 25 ? ? -69.72 94.96 16 12 MET A 26 ? ? -118.28 -74.53 17 13 PHE A 22 ? ? -100.04 40.11 18 13 PRO A 25 ? ? -69.69 84.05 19 14 MET A 26 ? ? -81.75 -73.81 20 14 PRO A 33 ? ? -69.82 95.57 21 16 PHE A 22 ? ? -99.63 40.03 22 17 PHE A 22 ? ? -98.97 35.90 23 18 PHE A 22 ? ? -100.70 40.05 24 19 PHE A 22 ? ? -99.79 36.53 25 19 VAL A 27 ? ? -173.08 142.79 26 20 PRO A 25 ? ? -69.77 84.16 27 20 MET A 26 ? ? -65.24 -71.42 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MWT _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MWT _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM crotalicidin, 30 mM [U-98% 2H] DPC, 0.1 mM DSS, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM crotalicidin, 30 mM [U-98% 2H] DPC, 0.1 mM DSS, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id crotalicidin-1 1 ? mM ? 1 DPC-2 30 ? mM '[U-98% 2H]' 1 DSS-3 0.1 ? mM ? 1 crotalicidin-4 1 ? mM ? 2 DPC-5 30 ? mM '[U-98% 2H]' 2 DSS-6 0.1 ? mM ? 2 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 0 3.0 ambient ? 298 K 2 0 3.0 ambient ? 308 K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H COSY' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' 2 4 1 '2D 1H-1H COSY' 2 5 1 '2D 1H-1H TOCSY' 2 6 1 '2D 1H-1H NOESY' 1 7 2 '2D 1H-1H COSY' 1 8 2 '2D 1H-1H TOCSY' 1 9 2 '2D 1H-1H NOESY' 1 10 2 '2D 1H-13C HSQC aliphatic' 1 11 2 '2D 1H-13C HSQC aromatic' 2 12 2 '2D 1H-1H COSY' 2 13 2 '2D 1H-1H TOCSY' 2 14 2 '2D 1H-1H NOESY' 2 15 2 '2D 1H-13C HSQC aliphatic' 2 16 2 '2D 1H-13C HSQC aromatic' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MWT _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 461 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 219 _pdbx_nmr_constraints.NOE_long_range_total_count 0 _pdbx_nmr_constraints.NOE_medium_range_total_count 116 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 126 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 30 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 29 # _pdbx_nmr_refine.entry_id 2MWT _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Goddard 'chemical shift assignment' Sparky ? 1 Goddard 'data analysis' Sparky ? 2 'Bruker Biospin' collection TopSpin ? 3 'Bruker Biospin' processing TopSpin ? 4 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 6 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 GLY N N N N 28 GLY CA C N N 29 GLY C C N N 30 GLY O O N N 31 GLY OXT O N N 32 GLY H H N N 33 GLY H2 H N N 34 GLY HA2 H N N 35 GLY HA3 H N N 36 GLY HXT H N N 37 ILE N N N N 38 ILE CA C N S 39 ILE C C N N 40 ILE O O N N 41 ILE CB C N S 42 ILE CG1 C N N 43 ILE CG2 C N N 44 ILE CD1 C N N 45 ILE OXT O N N 46 ILE H H N N 47 ILE H2 H N N 48 ILE HA H N N 49 ILE HB H N N 50 ILE HG12 H N N 51 ILE HG13 H N N 52 ILE HG21 H N N 53 ILE HG22 H N N 54 ILE HG23 H N N 55 ILE HD11 H N N 56 ILE HD12 H N N 57 ILE HD13 H N N 58 ILE HXT H N N 59 LEU N N N N 60 LEU CA C N S 61 LEU C C N N 62 LEU O O N N 63 LEU CB C N N 64 LEU CG C N N 65 LEU CD1 C N N 66 LEU CD2 C N N 67 LEU OXT O N N 68 LEU H H N N 69 LEU H2 H N N 70 LEU HA H N N 71 LEU HB2 H N N 72 LEU HB3 H N N 73 LEU HG H N N 74 LEU HD11 H N N 75 LEU HD12 H N N 76 LEU HD13 H N N 77 LEU HD21 H N N 78 LEU HD22 H N N 79 LEU HD23 H N N 80 LEU HXT H N N 81 LYS N N N N 82 LYS CA C N S 83 LYS C C N N 84 LYS O O N N 85 LYS CB C N N 86 LYS CG C N N 87 LYS CD C N N 88 LYS CE C N N 89 LYS NZ N N N 90 LYS OXT O N N 91 LYS H H N N 92 LYS H2 H N N 93 LYS HA H N N 94 LYS HB2 H N N 95 LYS HB3 H N N 96 LYS HG2 H N N 97 LYS HG3 H N N 98 LYS HD2 H N N 99 LYS HD3 H N N 100 LYS HE2 H N N 101 LYS HE3 H N N 102 LYS HZ1 H N N 103 LYS HZ2 H N N 104 LYS HZ3 H N N 105 LYS HXT H N N 106 MET N N N N 107 MET CA C N S 108 MET C C N N 109 MET O O N N 110 MET CB C N N 111 MET CG C N N 112 MET SD S N N 113 MET CE C N N 114 MET OXT O N N 115 MET H H N N 116 MET H2 H N N 117 MET HA H N N 118 MET HB2 H N N 119 MET HB3 H N N 120 MET HG2 H N N 121 MET HG3 H N N 122 MET HE1 H N N 123 MET HE2 H N N 124 MET HE3 H N N 125 MET HXT H N N 126 PHE N N N N 127 PHE CA C N S 128 PHE C C N N 129 PHE O O N N 130 PHE CB C N N 131 PHE CG C Y N 132 PHE CD1 C Y N 133 PHE CD2 C Y N 134 PHE CE1 C Y N 135 PHE CE2 C Y N 136 PHE CZ C Y N 137 PHE OXT O N N 138 PHE H H N N 139 PHE H2 H N N 140 PHE HA H N N 141 PHE HB2 H N N 142 PHE HB3 H N N 143 PHE HD1 H N N 144 PHE HD2 H N N 145 PHE HE1 H N N 146 PHE HE2 H N N 147 PHE HZ H N N 148 PHE HXT H N N 149 PRO N N N N 150 PRO CA C N S 151 PRO C C N N 152 PRO O O N N 153 PRO CB C N N 154 PRO CG C N N 155 PRO CD C N N 156 PRO OXT O N N 157 PRO H H N N 158 PRO HA H N N 159 PRO HB2 H N N 160 PRO HB3 H N N 161 PRO HG2 H N N 162 PRO HG3 H N N 163 PRO HD2 H N N 164 PRO HD3 H N N 165 PRO HXT H N N 166 SER N N N N 167 SER CA C N S 168 SER C C N N 169 SER O O N N 170 SER CB C N N 171 SER OG O N N 172 SER OXT O N N 173 SER H H N N 174 SER H2 H N N 175 SER HA H N N 176 SER HB2 H N N 177 SER HB3 H N N 178 SER HG H N N 179 SER HXT H N N 180 THR N N N N 181 THR CA C N S 182 THR C C N N 183 THR O O N N 184 THR CB C N R 185 THR OG1 O N N 186 THR CG2 C N N 187 THR OXT O N N 188 THR H H N N 189 THR H2 H N N 190 THR HA H N N 191 THR HB H N N 192 THR HG1 H N N 193 THR HG21 H N N 194 THR HG22 H N N 195 THR HG23 H N N 196 THR HXT H N N 197 VAL N N N N 198 VAL CA C N S 199 VAL C C N N 200 VAL O O N N 201 VAL CB C N N 202 VAL CG1 C N N 203 VAL CG2 C N N 204 VAL OXT O N N 205 VAL H H N N 206 VAL H2 H N N 207 VAL HA H N N 208 VAL HB H N N 209 VAL HG11 H N N 210 VAL HG12 H N N 211 VAL HG13 H N N 212 VAL HG21 H N N 213 VAL HG22 H N N 214 VAL HG23 H N N 215 VAL HXT H N N 216 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 GLY N CA sing N N 27 GLY N H sing N N 28 GLY N H2 sing N N 29 GLY CA C sing N N 30 GLY CA HA2 sing N N 31 GLY CA HA3 sing N N 32 GLY C O doub N N 33 GLY C OXT sing N N 34 GLY OXT HXT sing N N 35 ILE N CA sing N N 36 ILE N H sing N N 37 ILE N H2 sing N N 38 ILE CA C sing N N 39 ILE CA CB sing N N 40 ILE CA HA sing N N 41 ILE C O doub N N 42 ILE C OXT sing N N 43 ILE CB CG1 sing N N 44 ILE CB CG2 sing N N 45 ILE CB HB sing N N 46 ILE CG1 CD1 sing N N 47 ILE CG1 HG12 sing N N 48 ILE CG1 HG13 sing N N 49 ILE CG2 HG21 sing N N 50 ILE CG2 HG22 sing N N 51 ILE CG2 HG23 sing N N 52 ILE CD1 HD11 sing N N 53 ILE CD1 HD12 sing N N 54 ILE CD1 HD13 sing N N 55 ILE OXT HXT sing N N 56 LEU N CA sing N N 57 LEU N H sing N N 58 LEU N H2 sing N N 59 LEU CA C sing N N 60 LEU CA CB sing N N 61 LEU CA HA sing N N 62 LEU C O doub N N 63 LEU C OXT sing N N 64 LEU CB CG sing N N 65 LEU CB HB2 sing N N 66 LEU CB HB3 sing N N 67 LEU CG CD1 sing N N 68 LEU CG CD2 sing N N 69 LEU CG HG sing N N 70 LEU CD1 HD11 sing N N 71 LEU CD1 HD12 sing N N 72 LEU CD1 HD13 sing N N 73 LEU CD2 HD21 sing N N 74 LEU CD2 HD22 sing N N 75 LEU CD2 HD23 sing N N 76 LEU OXT HXT sing N N 77 LYS N CA sing N N 78 LYS N H sing N N 79 LYS N H2 sing N N 80 LYS CA C sing N N 81 LYS CA CB sing N N 82 LYS CA HA sing N N 83 LYS C O doub N N 84 LYS C OXT sing N N 85 LYS CB CG sing N N 86 LYS CB HB2 sing N N 87 LYS CB HB3 sing N N 88 LYS CG CD sing N N 89 LYS CG HG2 sing N N 90 LYS CG HG3 sing N N 91 LYS CD CE sing N N 92 LYS CD HD2 sing N N 93 LYS CD HD3 sing N N 94 LYS CE NZ sing N N 95 LYS CE HE2 sing N N 96 LYS CE HE3 sing N N 97 LYS NZ HZ1 sing N N 98 LYS NZ HZ2 sing N N 99 LYS NZ HZ3 sing N N 100 LYS OXT HXT sing N N 101 MET N CA sing N N 102 MET N H sing N N 103 MET N H2 sing N N 104 MET CA C sing N N 105 MET CA CB sing N N 106 MET CA HA sing N N 107 MET C O doub N N 108 MET C OXT sing N N 109 MET CB CG sing N N 110 MET CB HB2 sing N N 111 MET CB HB3 sing N N 112 MET CG SD sing N N 113 MET CG HG2 sing N N 114 MET CG HG3 sing N N 115 MET SD CE sing N N 116 MET CE HE1 sing N N 117 MET CE HE2 sing N N 118 MET CE HE3 sing N N 119 MET OXT HXT sing N N 120 PHE N CA sing N N 121 PHE N H sing N N 122 PHE N H2 sing N N 123 PHE CA C sing N N 124 PHE CA CB sing N N 125 PHE CA HA sing N N 126 PHE C O doub N N 127 PHE C OXT sing N N 128 PHE CB CG sing N N 129 PHE CB HB2 sing N N 130 PHE CB HB3 sing N N 131 PHE CG CD1 doub Y N 132 PHE CG CD2 sing Y N 133 PHE CD1 CE1 sing Y N 134 PHE CD1 HD1 sing N N 135 PHE CD2 CE2 doub Y N 136 PHE CD2 HD2 sing N N 137 PHE CE1 CZ doub Y N 138 PHE CE1 HE1 sing N N 139 PHE CE2 CZ sing Y N 140 PHE CE2 HE2 sing N N 141 PHE CZ HZ sing N N 142 PHE OXT HXT sing N N 143 PRO N CA sing N N 144 PRO N CD sing N N 145 PRO N H sing N N 146 PRO CA C sing N N 147 PRO CA CB sing N N 148 PRO CA HA sing N N 149 PRO C O doub N N 150 PRO C OXT sing N N 151 PRO CB CG sing N N 152 PRO CB HB2 sing N N 153 PRO CB HB3 sing N N 154 PRO CG CD sing N N 155 PRO CG HG2 sing N N 156 PRO CG HG3 sing N N 157 PRO CD HD2 sing N N 158 PRO CD HD3 sing N N 159 PRO OXT HXT sing N N 160 SER N CA sing N N 161 SER N H sing N N 162 SER N H2 sing N N 163 SER CA C sing N N 164 SER CA CB sing N N 165 SER CA HA sing N N 166 SER C O doub N N 167 SER C OXT sing N N 168 SER CB OG sing N N 169 SER CB HB2 sing N N 170 SER CB HB3 sing N N 171 SER OG HG sing N N 172 SER OXT HXT sing N N 173 THR N CA sing N N 174 THR N H sing N N 175 THR N H2 sing N N 176 THR CA C sing N N 177 THR CA CB sing N N 178 THR CA HA sing N N 179 THR C O doub N N 180 THR C OXT sing N N 181 THR CB OG1 sing N N 182 THR CB CG2 sing N N 183 THR CB HB sing N N 184 THR OG1 HG1 sing N N 185 THR CG2 HG21 sing N N 186 THR CG2 HG22 sing N N 187 THR CG2 HG23 sing N N 188 THR OXT HXT sing N N 189 VAL N CA sing N N 190 VAL N H sing N N 191 VAL N H2 sing N N 192 VAL CA C sing N N 193 VAL CA CB sing N N 194 VAL CA HA sing N N 195 VAL C O doub N N 196 VAL C OXT sing N N 197 VAL CB CG1 sing N N 198 VAL CB CG2 sing N N 199 VAL CB HB sing N N 200 VAL CG1 HG11 sing N N 201 VAL CG1 HG12 sing N N 202 VAL CG1 HG13 sing N N 203 VAL CG2 HG21 sing N N 204 VAL CG2 HG22 sing N N 205 VAL CG2 HG23 sing N N 206 VAL OXT HXT sing N N 207 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2MWT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #