data_2MXB # _entry.id 2MXB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104160 RCSB ? ? 2MXB PDB pdb_00002mxb 10.2210/pdb2mxb/pdb 25396 BMRB ? 10.13018/BMR25396 D_1000104160 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-23 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' pdbx_nmr_spectrometer 6 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_software.name' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' 5 2 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MXB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-12-19 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_id 25396 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, Q.' 1 'Wong, Y.' 2 'Lee, M.' 3 'Kang, C.' 4 # _citation.id primary _citation.title 'Solution structure of the transmembrane domain of the mouse erythropoietin receptor in detergent micelles.' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 5 _citation.page_first 13586 _citation.page_last 13586 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26316120 _citation.pdbx_database_id_DOI 10.1038/srep13586 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, Q.' 1 ? primary 'Lei Wong, Y.' 2 ? primary 'Yueqi Lee, M.' 3 ? primary 'Li, Y.' 4 ? primary 'Kang, C.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Erythropoietin receptor' _entity.formula_weight 6254.441 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Helical Transmembrane residues 236-283' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name EPO-R # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MSEPASLLTASDLDPLILTLSLILVLISLLLTVLALLSHRRTLQQKIWPHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MSEPASLLTASDLDPLILTLSLILVLISLLLTVLALLSHRRTLQQKIWPHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 PRO n 1 5 ALA n 1 6 SER n 1 7 LEU n 1 8 LEU n 1 9 THR n 1 10 ALA n 1 11 SER n 1 12 ASP n 1 13 LEU n 1 14 ASP n 1 15 PRO n 1 16 LEU n 1 17 ILE n 1 18 LEU n 1 19 THR n 1 20 LEU n 1 21 SER n 1 22 LEU n 1 23 ILE n 1 24 LEU n 1 25 VAL n 1 26 LEU n 1 27 ILE n 1 28 SER n 1 29 LEU n 1 30 LEU n 1 31 LEU n 1 32 THR n 1 33 VAL n 1 34 LEU n 1 35 ALA n 1 36 LEU n 1 37 LEU n 1 38 SER n 1 39 HIS n 1 40 ARG n 1 41 ARG n 1 42 THR n 1 43 LEU n 1 44 GLN n 1 45 GLN n 1 46 LYS n 1 47 ILE n 1 48 TRP n 1 49 PRO n 1 50 HIS n 1 51 HIS n 1 52 HIS n 1 53 HIS n 1 54 HIS n 1 55 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Epor _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Bl21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET29b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 HIS 50 50 ? ? ? A . n A 1 51 HIS 51 51 ? ? ? A . n A 1 52 HIS 52 52 ? ? ? A . n A 1 53 HIS 53 53 ? ? ? A . n A 1 54 HIS 54 54 ? ? ? A . n A 1 55 HIS 55 55 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MXB _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MXB _struct.title 'Structure of the transmembrane domain of the mouse erythropoietin receptor' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MXB _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EPOR_MOUSE _struct_ref.pdbx_db_accession P14753 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SEPASLLTASDLDPLILTLSLILVLISLLLTVLALLSHRRTLQQKIWP _struct_ref.pdbx_align_begin 236 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MXB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P14753 _struct_ref_seq.db_align_beg 236 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 283 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 49 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MXB MET A 1 ? UNP P14753 ? ? 'expression tag' 1 1 1 2MXB HIS A 50 ? UNP P14753 ? ? 'expression tag' 50 2 1 2MXB HIS A 51 ? UNP P14753 ? ? 'expression tag' 51 3 1 2MXB HIS A 52 ? UNP P14753 ? ? 'expression tag' 52 4 1 2MXB HIS A 53 ? UNP P14753 ? ? 'expression tag' 53 5 1 2MXB HIS A 54 ? UNP P14753 ? ? 'expression tag' 54 6 1 2MXB HIS A 55 ? UNP P14753 ? ? 'expression tag' 55 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 4 ? ALA A 10 ? PRO A 4 ALA A 10 1 ? 7 HELX_P HELX_P2 2 ASP A 14 ? TRP A 48 ? ASP A 14 TRP A 48 1 ? 35 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 5 ? ? -59.04 -6.00 2 1 ASP A 14 ? ? -171.65 82.22 3 3 ASP A 14 ? ? -172.51 82.65 4 4 SER A 2 ? ? -152.56 10.30 5 4 ALA A 5 ? ? -52.12 -7.64 6 4 ASP A 14 ? ? -160.34 82.39 7 5 GLU A 3 ? ? 19.07 72.27 8 5 ASP A 14 ? ? -174.43 83.39 9 6 SER A 2 ? ? -170.58 15.91 10 6 GLU A 3 ? ? -146.86 54.05 11 6 ASP A 14 ? ? -170.28 82.25 12 7 SER A 2 ? ? -165.53 -15.80 13 7 ALA A 5 ? ? -58.96 -8.27 14 7 ASP A 14 ? ? -169.02 82.07 15 10 SER A 2 ? ? 52.22 11.18 16 10 ALA A 10 ? ? -63.65 1.92 17 10 ASP A 14 ? ? -21.66 87.09 18 11 SER A 2 ? ? -160.20 11.77 19 11 LEU A 13 ? ? -141.65 15.31 20 12 GLU A 3 ? ? -21.71 87.92 21 12 ALA A 5 ? ? -59.07 -5.84 22 12 ASP A 14 ? ? -156.63 82.55 23 13 SER A 11 ? ? -50.72 -72.17 24 13 ASP A 12 ? ? -144.58 23.62 25 14 SER A 2 ? ? -152.11 23.19 26 14 ALA A 5 ? ? -58.23 -3.87 27 14 ASP A 12 ? ? -62.60 10.05 28 14 ASP A 14 ? ? -170.28 81.58 29 15 ASP A 12 ? ? -144.16 21.13 30 15 LEU A 13 ? ? -142.33 37.86 31 16 SER A 2 ? ? 46.34 15.95 32 16 ASP A 12 ? ? -62.17 1.09 33 16 ASP A 14 ? ? -23.25 88.48 34 17 SER A 2 ? ? -167.11 5.86 35 17 GLU A 3 ? ? -169.76 54.81 36 17 ALA A 5 ? ? -54.19 -4.52 37 17 LEU A 13 ? ? -144.20 15.56 38 18 GLU A 3 ? ? -159.13 61.53 39 18 ASP A 12 ? ? -66.44 1.55 40 18 ASP A 14 ? ? -169.00 82.68 41 20 THR A 9 ? ? -54.85 -9.97 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MXB _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MXB _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5-1 mM [U-100% 15N] protein, 20 mM potassium phosphate, 240 mM [U-100% 15N] DPC, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.8 mM [U-100% 13C; U-100% 15N] protein, 20 mM sodium phosphate, 240 mM [U-2H] DPC, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 ? 0.5-1 mM '[U-100% 15N]' 1 'potassium phosphate-2' 20 ? mM ? 1 DPC-3 240 ? mM '[U-100% 15N]' 1 entity-4 0.8 ? mM '[U-100% 13C; U-100% 15N]' 2 'sodium phosphate-5' 20 ? mM ? 2 DPC-6 240 ? mM '[U-2H]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-15N HSQC' 1 3 2 '3D CBCA(CO)NH' 1 4 2 '3D HNCACB' 1 5 2 '3D HNCA' 1 6 2 '3D HNCO' 1 7 2 '3D HBHA(CO)NH' 1 8 2 '3D 1H-15N NOESY' 1 9 1 '3D HCACO' # _pdbx_nmr_refine.entry_id 2MXB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;SIMULATED ANNEALING WAS STARTED WITH 3500 AND COOL DOWN TO 100 K WITH 15,000 STEPS. STRUCTURE WAS ENERGY MINIMIZED WITH POWELL ENERGY MINIMIZATION. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'structure solution' NMRPipe ? 2 'Bruker Biospin' collection TopSpin ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 50 ? A HIS 50 2 1 Y 1 A HIS 51 ? A HIS 51 3 1 Y 1 A HIS 52 ? A HIS 52 4 1 Y 1 A HIS 53 ? A HIS 53 5 1 Y 1 A HIS 54 ? A HIS 54 6 1 Y 1 A HIS 55 ? A HIS 55 7 2 Y 1 A HIS 50 ? A HIS 50 8 2 Y 1 A HIS 51 ? A HIS 51 9 2 Y 1 A HIS 52 ? A HIS 52 10 2 Y 1 A HIS 53 ? A HIS 53 11 2 Y 1 A HIS 54 ? A HIS 54 12 2 Y 1 A HIS 55 ? A HIS 55 13 3 Y 1 A HIS 50 ? A HIS 50 14 3 Y 1 A HIS 51 ? A HIS 51 15 3 Y 1 A HIS 52 ? A HIS 52 16 3 Y 1 A HIS 53 ? A HIS 53 17 3 Y 1 A HIS 54 ? A HIS 54 18 3 Y 1 A HIS 55 ? A HIS 55 19 4 Y 1 A HIS 50 ? A HIS 50 20 4 Y 1 A HIS 51 ? A HIS 51 21 4 Y 1 A HIS 52 ? A HIS 52 22 4 Y 1 A HIS 53 ? A HIS 53 23 4 Y 1 A HIS 54 ? A HIS 54 24 4 Y 1 A HIS 55 ? A HIS 55 25 5 Y 1 A HIS 50 ? A HIS 50 26 5 Y 1 A HIS 51 ? A HIS 51 27 5 Y 1 A HIS 52 ? A HIS 52 28 5 Y 1 A HIS 53 ? A HIS 53 29 5 Y 1 A HIS 54 ? A HIS 54 30 5 Y 1 A HIS 55 ? A HIS 55 31 6 Y 1 A HIS 50 ? A HIS 50 32 6 Y 1 A HIS 51 ? A HIS 51 33 6 Y 1 A HIS 52 ? A HIS 52 34 6 Y 1 A HIS 53 ? A HIS 53 35 6 Y 1 A HIS 54 ? A HIS 54 36 6 Y 1 A HIS 55 ? A HIS 55 37 7 Y 1 A HIS 50 ? A HIS 50 38 7 Y 1 A HIS 51 ? A HIS 51 39 7 Y 1 A HIS 52 ? A HIS 52 40 7 Y 1 A HIS 53 ? A HIS 53 41 7 Y 1 A HIS 54 ? A HIS 54 42 7 Y 1 A HIS 55 ? A HIS 55 43 8 Y 1 A HIS 50 ? A HIS 50 44 8 Y 1 A HIS 51 ? A HIS 51 45 8 Y 1 A HIS 52 ? A HIS 52 46 8 Y 1 A HIS 53 ? A HIS 53 47 8 Y 1 A HIS 54 ? A HIS 54 48 8 Y 1 A HIS 55 ? A HIS 55 49 9 Y 1 A HIS 50 ? A HIS 50 50 9 Y 1 A HIS 51 ? A HIS 51 51 9 Y 1 A HIS 52 ? A HIS 52 52 9 Y 1 A HIS 53 ? A HIS 53 53 9 Y 1 A HIS 54 ? A HIS 54 54 9 Y 1 A HIS 55 ? A HIS 55 55 10 Y 1 A HIS 50 ? A HIS 50 56 10 Y 1 A HIS 51 ? A HIS 51 57 10 Y 1 A HIS 52 ? A HIS 52 58 10 Y 1 A HIS 53 ? A HIS 53 59 10 Y 1 A HIS 54 ? A HIS 54 60 10 Y 1 A HIS 55 ? A HIS 55 61 11 Y 1 A HIS 50 ? A HIS 50 62 11 Y 1 A HIS 51 ? A HIS 51 63 11 Y 1 A HIS 52 ? A HIS 52 64 11 Y 1 A HIS 53 ? A HIS 53 65 11 Y 1 A HIS 54 ? A HIS 54 66 11 Y 1 A HIS 55 ? A HIS 55 67 12 Y 1 A HIS 50 ? A HIS 50 68 12 Y 1 A HIS 51 ? A HIS 51 69 12 Y 1 A HIS 52 ? A HIS 52 70 12 Y 1 A HIS 53 ? A HIS 53 71 12 Y 1 A HIS 54 ? A HIS 54 72 12 Y 1 A HIS 55 ? A HIS 55 73 13 Y 1 A HIS 50 ? A HIS 50 74 13 Y 1 A HIS 51 ? A HIS 51 75 13 Y 1 A HIS 52 ? A HIS 52 76 13 Y 1 A HIS 53 ? A HIS 53 77 13 Y 1 A HIS 54 ? A HIS 54 78 13 Y 1 A HIS 55 ? A HIS 55 79 14 Y 1 A HIS 50 ? A HIS 50 80 14 Y 1 A HIS 51 ? A HIS 51 81 14 Y 1 A HIS 52 ? A HIS 52 82 14 Y 1 A HIS 53 ? A HIS 53 83 14 Y 1 A HIS 54 ? A HIS 54 84 14 Y 1 A HIS 55 ? A HIS 55 85 15 Y 1 A HIS 50 ? A HIS 50 86 15 Y 1 A HIS 51 ? A HIS 51 87 15 Y 1 A HIS 52 ? A HIS 52 88 15 Y 1 A HIS 53 ? A HIS 53 89 15 Y 1 A HIS 54 ? A HIS 54 90 15 Y 1 A HIS 55 ? A HIS 55 91 16 Y 1 A HIS 50 ? A HIS 50 92 16 Y 1 A HIS 51 ? A HIS 51 93 16 Y 1 A HIS 52 ? A HIS 52 94 16 Y 1 A HIS 53 ? A HIS 53 95 16 Y 1 A HIS 54 ? A HIS 54 96 16 Y 1 A HIS 55 ? A HIS 55 97 17 Y 1 A HIS 50 ? A HIS 50 98 17 Y 1 A HIS 51 ? A HIS 51 99 17 Y 1 A HIS 52 ? A HIS 52 100 17 Y 1 A HIS 53 ? A HIS 53 101 17 Y 1 A HIS 54 ? A HIS 54 102 17 Y 1 A HIS 55 ? A HIS 55 103 18 Y 1 A HIS 50 ? A HIS 50 104 18 Y 1 A HIS 51 ? A HIS 51 105 18 Y 1 A HIS 52 ? A HIS 52 106 18 Y 1 A HIS 53 ? A HIS 53 107 18 Y 1 A HIS 54 ? A HIS 54 108 18 Y 1 A HIS 55 ? A HIS 55 109 19 Y 1 A HIS 50 ? A HIS 50 110 19 Y 1 A HIS 51 ? A HIS 51 111 19 Y 1 A HIS 52 ? A HIS 52 112 19 Y 1 A HIS 53 ? A HIS 53 113 19 Y 1 A HIS 54 ? A HIS 54 114 19 Y 1 A HIS 55 ? A HIS 55 115 20 Y 1 A HIS 50 ? A HIS 50 116 20 Y 1 A HIS 51 ? A HIS 51 117 20 Y 1 A HIS 52 ? A HIS 52 118 20 Y 1 A HIS 53 ? A HIS 53 119 20 Y 1 A HIS 54 ? A HIS 54 120 20 Y 1 A HIS 55 ? A HIS 55 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 HIS N N N N 96 HIS CA C N S 97 HIS C C N N 98 HIS O O N N 99 HIS CB C N N 100 HIS CG C Y N 101 HIS ND1 N Y N 102 HIS CD2 C Y N 103 HIS CE1 C Y N 104 HIS NE2 N Y N 105 HIS OXT O N N 106 HIS H H N N 107 HIS H2 H N N 108 HIS HA H N N 109 HIS HB2 H N N 110 HIS HB3 H N N 111 HIS HD1 H N N 112 HIS HD2 H N N 113 HIS HE1 H N N 114 HIS HE2 H N N 115 HIS HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LEU N N N N 139 LEU CA C N S 140 LEU C C N N 141 LEU O O N N 142 LEU CB C N N 143 LEU CG C N N 144 LEU CD1 C N N 145 LEU CD2 C N N 146 LEU OXT O N N 147 LEU H H N N 148 LEU H2 H N N 149 LEU HA H N N 150 LEU HB2 H N N 151 LEU HB3 H N N 152 LEU HG H N N 153 LEU HD11 H N N 154 LEU HD12 H N N 155 LEU HD13 H N N 156 LEU HD21 H N N 157 LEU HD22 H N N 158 LEU HD23 H N N 159 LEU HXT H N N 160 LYS N N N N 161 LYS CA C N S 162 LYS C C N N 163 LYS O O N N 164 LYS CB C N N 165 LYS CG C N N 166 LYS CD C N N 167 LYS CE C N N 168 LYS NZ N N N 169 LYS OXT O N N 170 LYS H H N N 171 LYS H2 H N N 172 LYS HA H N N 173 LYS HB2 H N N 174 LYS HB3 H N N 175 LYS HG2 H N N 176 LYS HG3 H N N 177 LYS HD2 H N N 178 LYS HD3 H N N 179 LYS HE2 H N N 180 LYS HE3 H N N 181 LYS HZ1 H N N 182 LYS HZ2 H N N 183 LYS HZ3 H N N 184 LYS HXT H N N 185 MET N N N N 186 MET CA C N S 187 MET C C N N 188 MET O O N N 189 MET CB C N N 190 MET CG C N N 191 MET SD S N N 192 MET CE C N N 193 MET OXT O N N 194 MET H H N N 195 MET H2 H N N 196 MET HA H N N 197 MET HB2 H N N 198 MET HB3 H N N 199 MET HG2 H N N 200 MET HG3 H N N 201 MET HE1 H N N 202 MET HE2 H N N 203 MET HE3 H N N 204 MET HXT H N N 205 PRO N N N N 206 PRO CA C N S 207 PRO C C N N 208 PRO O O N N 209 PRO CB C N N 210 PRO CG C N N 211 PRO CD C N N 212 PRO OXT O N N 213 PRO H H N N 214 PRO HA H N N 215 PRO HB2 H N N 216 PRO HB3 H N N 217 PRO HG2 H N N 218 PRO HG3 H N N 219 PRO HD2 H N N 220 PRO HD3 H N N 221 PRO HXT H N N 222 SER N N N N 223 SER CA C N S 224 SER C C N N 225 SER O O N N 226 SER CB C N N 227 SER OG O N N 228 SER OXT O N N 229 SER H H N N 230 SER H2 H N N 231 SER HA H N N 232 SER HB2 H N N 233 SER HB3 H N N 234 SER HG H N N 235 SER HXT H N N 236 THR N N N N 237 THR CA C N S 238 THR C C N N 239 THR O O N N 240 THR CB C N R 241 THR OG1 O N N 242 THR CG2 C N N 243 THR OXT O N N 244 THR H H N N 245 THR H2 H N N 246 THR HA H N N 247 THR HB H N N 248 THR HG1 H N N 249 THR HG21 H N N 250 THR HG22 H N N 251 THR HG23 H N N 252 THR HXT H N N 253 TRP N N N N 254 TRP CA C N S 255 TRP C C N N 256 TRP O O N N 257 TRP CB C N N 258 TRP CG C Y N 259 TRP CD1 C Y N 260 TRP CD2 C Y N 261 TRP NE1 N Y N 262 TRP CE2 C Y N 263 TRP CE3 C Y N 264 TRP CZ2 C Y N 265 TRP CZ3 C Y N 266 TRP CH2 C Y N 267 TRP OXT O N N 268 TRP H H N N 269 TRP H2 H N N 270 TRP HA H N N 271 TRP HB2 H N N 272 TRP HB3 H N N 273 TRP HD1 H N N 274 TRP HE1 H N N 275 TRP HE3 H N N 276 TRP HZ2 H N N 277 TRP HZ3 H N N 278 TRP HH2 H N N 279 TRP HXT H N N 280 VAL N N N N 281 VAL CA C N S 282 VAL C C N N 283 VAL O O N N 284 VAL CB C N N 285 VAL CG1 C N N 286 VAL CG2 C N N 287 VAL OXT O N N 288 VAL H H N N 289 VAL H2 H N N 290 VAL HA H N N 291 VAL HB H N N 292 VAL HG11 H N N 293 VAL HG12 H N N 294 VAL HG13 H N N 295 VAL HG21 H N N 296 VAL HG22 H N N 297 VAL HG23 H N N 298 VAL HXT H N N 299 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 HIS N CA sing N N 91 HIS N H sing N N 92 HIS N H2 sing N N 93 HIS CA C sing N N 94 HIS CA CB sing N N 95 HIS CA HA sing N N 96 HIS C O doub N N 97 HIS C OXT sing N N 98 HIS CB CG sing N N 99 HIS CB HB2 sing N N 100 HIS CB HB3 sing N N 101 HIS CG ND1 sing Y N 102 HIS CG CD2 doub Y N 103 HIS ND1 CE1 doub Y N 104 HIS ND1 HD1 sing N N 105 HIS CD2 NE2 sing Y N 106 HIS CD2 HD2 sing N N 107 HIS CE1 NE2 sing Y N 108 HIS CE1 HE1 sing N N 109 HIS NE2 HE2 sing N N 110 HIS OXT HXT sing N N 111 ILE N CA sing N N 112 ILE N H sing N N 113 ILE N H2 sing N N 114 ILE CA C sing N N 115 ILE CA CB sing N N 116 ILE CA HA sing N N 117 ILE C O doub N N 118 ILE C OXT sing N N 119 ILE CB CG1 sing N N 120 ILE CB CG2 sing N N 121 ILE CB HB sing N N 122 ILE CG1 CD1 sing N N 123 ILE CG1 HG12 sing N N 124 ILE CG1 HG13 sing N N 125 ILE CG2 HG21 sing N N 126 ILE CG2 HG22 sing N N 127 ILE CG2 HG23 sing N N 128 ILE CD1 HD11 sing N N 129 ILE CD1 HD12 sing N N 130 ILE CD1 HD13 sing N N 131 ILE OXT HXT sing N N 132 LEU N CA sing N N 133 LEU N H sing N N 134 LEU N H2 sing N N 135 LEU CA C sing N N 136 LEU CA CB sing N N 137 LEU CA HA sing N N 138 LEU C O doub N N 139 LEU C OXT sing N N 140 LEU CB CG sing N N 141 LEU CB HB2 sing N N 142 LEU CB HB3 sing N N 143 LEU CG CD1 sing N N 144 LEU CG CD2 sing N N 145 LEU CG HG sing N N 146 LEU CD1 HD11 sing N N 147 LEU CD1 HD12 sing N N 148 LEU CD1 HD13 sing N N 149 LEU CD2 HD21 sing N N 150 LEU CD2 HD22 sing N N 151 LEU CD2 HD23 sing N N 152 LEU OXT HXT sing N N 153 LYS N CA sing N N 154 LYS N H sing N N 155 LYS N H2 sing N N 156 LYS CA C sing N N 157 LYS CA CB sing N N 158 LYS CA HA sing N N 159 LYS C O doub N N 160 LYS C OXT sing N N 161 LYS CB CG sing N N 162 LYS CB HB2 sing N N 163 LYS CB HB3 sing N N 164 LYS CG CD sing N N 165 LYS CG HG2 sing N N 166 LYS CG HG3 sing N N 167 LYS CD CE sing N N 168 LYS CD HD2 sing N N 169 LYS CD HD3 sing N N 170 LYS CE NZ sing N N 171 LYS CE HE2 sing N N 172 LYS CE HE3 sing N N 173 LYS NZ HZ1 sing N N 174 LYS NZ HZ2 sing N N 175 LYS NZ HZ3 sing N N 176 LYS OXT HXT sing N N 177 MET N CA sing N N 178 MET N H sing N N 179 MET N H2 sing N N 180 MET CA C sing N N 181 MET CA CB sing N N 182 MET CA HA sing N N 183 MET C O doub N N 184 MET C OXT sing N N 185 MET CB CG sing N N 186 MET CB HB2 sing N N 187 MET CB HB3 sing N N 188 MET CG SD sing N N 189 MET CG HG2 sing N N 190 MET CG HG3 sing N N 191 MET SD CE sing N N 192 MET CE HE1 sing N N 193 MET CE HE2 sing N N 194 MET CE HE3 sing N N 195 MET OXT HXT sing N N 196 PRO N CA sing N N 197 PRO N CD sing N N 198 PRO N H sing N N 199 PRO CA C sing N N 200 PRO CA CB sing N N 201 PRO CA HA sing N N 202 PRO C O doub N N 203 PRO C OXT sing N N 204 PRO CB CG sing N N 205 PRO CB HB2 sing N N 206 PRO CB HB3 sing N N 207 PRO CG CD sing N N 208 PRO CG HG2 sing N N 209 PRO CG HG3 sing N N 210 PRO CD HD2 sing N N 211 PRO CD HD3 sing N N 212 PRO OXT HXT sing N N 213 SER N CA sing N N 214 SER N H sing N N 215 SER N H2 sing N N 216 SER CA C sing N N 217 SER CA CB sing N N 218 SER CA HA sing N N 219 SER C O doub N N 220 SER C OXT sing N N 221 SER CB OG sing N N 222 SER CB HB2 sing N N 223 SER CB HB3 sing N N 224 SER OG HG sing N N 225 SER OXT HXT sing N N 226 THR N CA sing N N 227 THR N H sing N N 228 THR N H2 sing N N 229 THR CA C sing N N 230 THR CA CB sing N N 231 THR CA HA sing N N 232 THR C O doub N N 233 THR C OXT sing N N 234 THR CB OG1 sing N N 235 THR CB CG2 sing N N 236 THR CB HB sing N N 237 THR OG1 HG1 sing N N 238 THR CG2 HG21 sing N N 239 THR CG2 HG22 sing N N 240 THR CG2 HG23 sing N N 241 THR OXT HXT sing N N 242 TRP N CA sing N N 243 TRP N H sing N N 244 TRP N H2 sing N N 245 TRP CA C sing N N 246 TRP CA CB sing N N 247 TRP CA HA sing N N 248 TRP C O doub N N 249 TRP C OXT sing N N 250 TRP CB CG sing N N 251 TRP CB HB2 sing N N 252 TRP CB HB3 sing N N 253 TRP CG CD1 doub Y N 254 TRP CG CD2 sing Y N 255 TRP CD1 NE1 sing Y N 256 TRP CD1 HD1 sing N N 257 TRP CD2 CE2 doub Y N 258 TRP CD2 CE3 sing Y N 259 TRP NE1 CE2 sing Y N 260 TRP NE1 HE1 sing N N 261 TRP CE2 CZ2 sing Y N 262 TRP CE3 CZ3 doub Y N 263 TRP CE3 HE3 sing N N 264 TRP CZ2 CH2 doub Y N 265 TRP CZ2 HZ2 sing N N 266 TRP CZ3 CH2 sing Y N 267 TRP CZ3 HZ3 sing N N 268 TRP CH2 HH2 sing N N 269 TRP OXT HXT sing N N 270 VAL N CA sing N N 271 VAL N H sing N N 272 VAL N H2 sing N N 273 VAL CA C sing N N 274 VAL CA CB sing N N 275 VAL CA HA sing N N 276 VAL C O doub N N 277 VAL C OXT sing N N 278 VAL CB CG1 sing N N 279 VAL CB CG2 sing N N 280 VAL CB HB sing N N 281 VAL CG1 HG11 sing N N 282 VAL CG1 HG12 sing N N 283 VAL CG1 HG13 sing N N 284 VAL CG2 HG21 sing N N 285 VAL CG2 HG22 sing N N 286 VAL CG2 HG23 sing N N 287 VAL OXT HXT sing N N 288 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2MXB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S # loop_