data_2MXP # _entry.id 2MXP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104174 RCSB ? ? 2MXP PDB pdb_00002mxp 10.2210/pdb2mxp/pdb 25423 BMRB ? ? D_1000104174 WWPDB ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 4XKL PDB . unspecified 25423 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MXP _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2015-01-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pan, L.' 1 'Xie, X.' 2 # _citation.id primary _citation.title 'Molecular basis of ubiquitin recognition by the autophagy receptor CALCOCO2' _citation.journal_abbrev Autophagy _citation.journal_volume 11 _citation.page_first 1775 _citation.page_last 1789 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1554-8627 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26506893 _citation.pdbx_database_id_DOI 10.1080/15548627.2015.1082025 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xie, X.' 1 ? primary 'Li, F.' 2 ? primary 'Wang, Y.' 3 ? primary 'Wang, Y.' 4 ? primary 'Lin, Z.' 5 ? primary 'Cheng, X.' 6 ? primary 'Liu, J.' 7 ? primary 'Chen, C.' 8 ? primary 'Pan, L.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calcium-binding and coiled-coil domain-containing protein 2' 3887.546 1 ? ? 'C-terminal, UNP residues 414-446' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Antigen nuclear dot 52 kDa protein, Nuclear domain 10 protein NDP52, Nuclear domain 10 protein 52, Nuclear dot protein 52' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code QMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL _entity_poly.pdbx_seq_one_letter_code_can QMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 MET n 1 3 GLN n 1 4 PRO n 1 5 LEU n 1 6 CYS n 1 7 PHE n 1 8 ASN n 1 9 CYS n 1 10 PRO n 1 11 ILE n 1 12 CYS n 1 13 ASP n 1 14 LYS n 1 15 ILE n 1 16 PHE n 1 17 PRO n 1 18 ALA n 1 19 THR n 1 20 GLU n 1 21 LYS n 1 22 GLN n 1 23 ILE n 1 24 PHE n 1 25 GLU n 1 26 ASP n 1 27 HIS n 1 28 VAL n 1 29 PHE n 1 30 CYS n 1 31 HIS n 1 32 SER n 1 33 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CALCOCO2, NDP52' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET32a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CACO2_HUMAN _struct_ref.pdbx_db_accession Q13137 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL _struct_ref.pdbx_align_begin 414 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MXP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 33 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13137 _struct_ref_seq.db_align_beg 414 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 446 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 49 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D CBCA(CO)NH' 1 2 1 '3D HNCACB' 1 3 1 '3D 1H-15N NOESY' 1 4 1 '2D 1H-13C HSQC' 2 5 2 '3D HCCH-TOCSY' 2 6 2 '3D 1H-13C NOESY aliphatic' 2 7 3 '2D 1H-1H NOESY' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 0.1 6.5 ambient atm 298 K 2 0.1 6.5 ambient atm 298 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 13C; U-100% 15N] entity_1-1, 1 mM [U-100% 15N] entity_1-2, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 13C; U-100% 15N] entity_1-3, 100% D2O' 2 '100% D2O' '1.2 mM entity_1-4, 100% D2O' 3 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Agilent _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Agilent INOVA' # _pdbx_nmr_refine.entry_id 2MXP _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MXP _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MXP _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 1 ? Garrett 'chemical shift assignment' PIPP 2 ? Garrett 'data analysis' PIPP 3 ? Goddard 'data analysis' Sparky 4 ? Goddard 'chemical shift assignment' Sparky 5 ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 6 ? 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 7 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MXP _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MXP _struct.title 'Solution structure of NDP52 ubiquitin-binding zinc finger' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MXP _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'zinc finger, NDP52, ubiquitin-binding, C2H2-type, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 20 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 32 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 68 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 80 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 9 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 57 A ZN 101 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc2 metalc ? ? A CYS 12 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 60 A ZN 101 1_555 ? ? ? ? ? ? ? 2.290 ? ? metalc3 metalc ? ? A HIS 27 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 75 A ZN 101 1_555 ? ? ? ? ? ? ? 1.969 ? ? metalc4 metalc ? ? A HIS 31 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 79 A ZN 101 1_555 ? ? ? ? ? ? ? 2.021 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 6 ? ASN A 8 ? CYS A 54 ASN A 56 A 2 ILE A 15 ? PRO A 17 ? ILE A 63 PRO A 65 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id PHE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 7 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 55 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 16 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 64 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 9 ? CYS A 57 . ? 1_555 ? 2 AC1 4 CYS A 12 ? CYS A 60 . ? 1_555 ? 3 AC1 4 HIS A 27 ? HIS A 75 . ? 1_555 ? 4 AC1 4 HIS A 31 ? HIS A 79 . ? 1_555 ? # _atom_sites.entry_id 2MXP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 49 49 GLN GLN A . n A 1 2 MET 2 50 50 MET MET A . n A 1 3 GLN 3 51 51 GLN GLN A . n A 1 4 PRO 4 52 52 PRO PRO A . n A 1 5 LEU 5 53 53 LEU LEU A . n A 1 6 CYS 6 54 54 CYS CYS A . n A 1 7 PHE 7 55 55 PHE PHE A . n A 1 8 ASN 8 56 56 ASN ASN A . n A 1 9 CYS 9 57 57 CYS CYS A . n A 1 10 PRO 10 58 58 PRO PRO A . n A 1 11 ILE 11 59 59 ILE ILE A . n A 1 12 CYS 12 60 60 CYS CYS A . n A 1 13 ASP 13 61 61 ASP ASP A . n A 1 14 LYS 14 62 62 LYS LYS A . n A 1 15 ILE 15 63 63 ILE ILE A . n A 1 16 PHE 16 64 64 PHE PHE A . n A 1 17 PRO 17 65 65 PRO PRO A . n A 1 18 ALA 18 66 66 ALA ALA A . n A 1 19 THR 19 67 67 THR THR A . n A 1 20 GLU 20 68 68 GLU GLU A . n A 1 21 LYS 21 69 69 LYS LYS A . n A 1 22 GLN 22 70 70 GLN GLN A . n A 1 23 ILE 23 71 71 ILE ILE A . n A 1 24 PHE 24 72 72 PHE PHE A . n A 1 25 GLU 25 73 73 GLU GLU A . n A 1 26 ASP 26 74 74 ASP ASP A . n A 1 27 HIS 27 75 75 HIS HIS A . n A 1 28 VAL 28 76 76 VAL VAL A . n A 1 29 PHE 29 77 77 PHE PHE A . n A 1 30 CYS 30 78 78 CYS CYS A . n A 1 31 HIS 31 79 79 HIS HIS A . n A 1 32 SER 32 80 80 SER SER A . n A 1 33 LEU 33 81 81 LEU LEU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 82 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN2 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 9 ? A CYS 57 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 12 ? A CYS 60 ? 1_555 121.1 ? 2 SG ? A CYS 9 ? A CYS 57 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 27 ? A HIS 75 ? 1_555 102.2 ? 3 SG ? A CYS 12 ? A CYS 60 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 27 ? A HIS 75 ? 1_555 107.7 ? 4 SG ? A CYS 9 ? A CYS 57 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 31 ? A HIS 79 ? 1_555 108.3 ? 5 SG ? A CYS 12 ? A CYS 60 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 31 ? A HIS 79 ? 1_555 116.6 ? 6 NE2 ? A HIS 27 ? A HIS 75 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 31 ? A HIS 79 ? 1_555 97.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-11-11 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_struct_conn_angle 5 2 'Structure model' struct_conn 6 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.value' 16 2 'Structure model' '_struct_conn.pdbx_dist_value' 17 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 23 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 24 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity_1-1 1 ? mM '[U-100% 13C; U-100% 15N]' 1 entity_1-2 1 ? mM '[U-100% 15N]' 1 entity_1-3 1 ? mM '[U-100% 13C; U-100% 15N]' 2 entity_1-4 1.2 ? mM ? 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MXP _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 793 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 252 _pdbx_nmr_constraints.NOE_long_range_total_count 176 _pdbx_nmr_constraints.NOE_medium_range_total_count 159 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 206 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 35 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 17 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 51 ? ? 61.09 112.32 2 1 PRO A 52 ? ? -62.06 74.26 3 1 CYS A 54 ? ? -177.67 140.94 4 1 ASP A 61 ? ? 86.59 19.38 5 2 MET A 50 ? ? 62.24 150.21 6 2 PRO A 52 ? ? -54.30 174.64 7 2 CYS A 54 ? ? 177.68 147.36 8 2 ASP A 61 ? ? 82.14 24.76 9 2 GLU A 68 ? ? -97.88 33.07 10 3 MET A 50 ? ? -165.50 -46.57 11 3 CYS A 54 ? ? 178.17 -174.26 12 3 ASP A 61 ? ? 80.10 36.92 13 4 CYS A 54 ? ? 176.81 141.28 14 4 ASP A 61 ? ? 78.18 38.67 15 5 ASP A 61 ? ? 153.86 -37.94 16 5 LYS A 62 ? ? -31.20 127.54 17 5 GLU A 68 ? ? -98.92 35.13 18 6 CYS A 54 ? ? 179.47 -179.14 19 6 ASP A 61 ? ? 153.11 -37.93 20 6 LYS A 62 ? ? -30.72 126.32 21 6 GLU A 68 ? ? -97.45 33.21 22 7 PRO A 52 ? ? -69.59 76.21 23 7 CYS A 54 ? ? -170.32 -173.28 24 7 ASP A 61 ? ? 82.45 17.53 25 7 LYS A 62 ? ? -59.27 171.38 26 8 CYS A 54 ? ? -172.85 140.86 27 8 ASP A 61 ? ? 78.94 38.09 28 9 MET A 50 ? ? -103.34 74.47 29 9 LEU A 53 ? ? 74.40 32.36 30 9 ASP A 61 ? ? 86.79 13.68 31 10 GLN A 51 ? ? -153.81 85.24 32 10 PRO A 52 ? ? -54.31 -170.20 33 10 CYS A 54 ? ? 175.76 -175.50 34 10 ASP A 61 ? ? 76.67 39.67 35 11 MET A 50 ? ? -177.11 -39.42 36 11 GLN A 51 ? ? 60.64 69.89 37 11 PRO A 52 ? ? -56.41 171.96 38 11 ASP A 61 ? ? 96.52 7.89 39 12 MET A 50 ? ? -176.97 -52.02 40 12 GLN A 51 ? ? 61.82 147.02 41 12 CYS A 54 ? ? 171.62 -175.63 42 12 ASP A 61 ? ? 85.46 12.60 43 12 GLU A 68 ? ? -99.41 35.52 44 13 MET A 50 ? ? 59.98 97.87 45 13 PRO A 52 ? ? -67.81 76.99 46 13 CYS A 54 ? ? -176.44 139.06 47 13 ASP A 61 ? ? 84.51 33.90 48 13 GLU A 68 ? ? -97.63 32.43 49 14 MET A 50 ? ? -160.35 -66.44 50 14 GLN A 51 ? ? -48.90 102.56 51 15 MET A 50 ? ? 59.59 81.60 52 15 PRO A 52 ? ? -63.00 -177.94 53 15 CYS A 54 ? ? -175.27 -173.24 54 15 ASP A 61 ? ? 82.56 24.59 55 16 PRO A 52 ? ? -65.09 67.73 56 16 CYS A 54 ? ? -170.73 -173.25 57 16 ILE A 59 ? ? -127.26 -53.69 58 16 ASP A 61 ? ? 83.14 11.87 59 16 LYS A 62 ? ? -58.71 177.04 60 16 GLU A 68 ? ? -100.00 32.73 61 17 GLN A 51 ? ? 61.41 110.70 62 17 ASP A 61 ? ? 77.15 35.16 63 17 GLU A 68 ? ? -98.49 34.63 64 18 CYS A 54 ? ? -172.17 -179.95 65 18 ILE A 59 ? ? -128.12 -53.33 66 18 ASP A 61 ? ? 88.13 9.84 67 18 GLU A 68 ? ? -96.47 31.94 68 19 PRO A 52 ? ? -53.02 174.87 69 19 CYS A 54 ? ? -177.86 -173.27 70 19 ASP A 61 ? ? 88.84 23.83 71 20 MET A 50 ? ? 46.30 -170.20 72 20 PRO A 52 ? ? -54.94 -173.86 73 20 ASP A 61 ? ? 152.72 -38.24 74 20 LYS A 62 ? ? -30.03 129.65 75 20 GLU A 68 ? ? -98.43 30.15 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #