data_2MXP
# 
_entry.id   2MXP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
RCSB104174   RCSB  ?            ?                   
2MXP         PDB   pdb_00002mxp 10.2210/pdb2mxp/pdb 
25423        BMRB  ?            10.13018/BMR25423   
D_1000104174 WWPDB ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-11-11 
2 'Structure model' 1 1 2023-06-14 
3 'Structure model' 1 2 2024-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
4 2 'Structure model' Other                  
5 3 'Structure model' 'Data collection'      
6 3 'Structure model' 'Database references'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' database_2             
2 2 'Structure model' pdbx_database_status   
3 2 'Structure model' pdbx_nmr_software      
4 2 'Structure model' pdbx_struct_conn_angle 
5 2 'Structure model' struct_conn            
6 2 'Structure model' struct_site            
7 3 'Structure model' chem_comp_atom         
8 3 'Structure model' chem_comp_bond         
9 3 'Structure model' database_2             
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_database_2.pdbx_DOI'                        
2  2 'Structure model' '_database_2.pdbx_database_accession'         
3  2 'Structure model' '_pdbx_database_status.status_code_nmr_data'  
4  2 'Structure model' '_pdbx_nmr_software.name'                     
5  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
6  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
7  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
8  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
9  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
15 2 'Structure model' '_pdbx_struct_conn_angle.value'               
16 2 'Structure model' '_struct_conn.pdbx_dist_value'                
17 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
18 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
19 2 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
20 2 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
21 2 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
22 2 'Structure model' '_struct_site.pdbx_auth_asym_id'              
23 2 'Structure model' '_struct_site.pdbx_auth_comp_id'              
24 2 'Structure model' '_struct_site.pdbx_auth_seq_id'               
25 3 'Structure model' '_database_2.pdbx_DOI'                        
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2MXP 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2015-01-12 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4XKL  PDB  . 
unspecified 25423 BMRB . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pan, L.' 1 
'Xie, X.' 2 
# 
_citation.id                        primary 
_citation.title                     'Molecular basis of ubiquitin recognition by the autophagy receptor CALCOCO2' 
_citation.journal_abbrev            Autophagy 
_citation.journal_volume            11 
_citation.page_first                1775 
_citation.page_last                 1789 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1554-8627 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26506893 
_citation.pdbx_database_id_DOI      10.1080/15548627.2015.1082025 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Xie, X.'   1 ? 
primary 'Li, F.'    2 ? 
primary 'Wang, Y.'  3 ? 
primary 'Wang, Y.'  4 ? 
primary 'Lin, Z.'   5 ? 
primary 'Cheng, X.' 6 ? 
primary 'Liu, J.'   7 ? 
primary 'Chen, C.'  8 ? 
primary 'Pan, L.'   9 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Calcium-binding and coiled-coil domain-containing protein 2' 3887.546 1 ? ? 'C-terminal, UNP residues 414-446' 
? 
2 non-polymer syn 'ZINC ION'                                                    65.409   1 ? ? ?                                  
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Antigen nuclear dot 52 kDa protein, Nuclear domain 10 protein NDP52, Nuclear domain 10 protein 52, Nuclear dot protein 52' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       QMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL 
_entity_poly.pdbx_seq_one_letter_code_can   QMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLN n 
1 2  MET n 
1 3  GLN n 
1 4  PRO n 
1 5  LEU n 
1 6  CYS n 
1 7  PHE n 
1 8  ASN n 
1 9  CYS n 
1 10 PRO n 
1 11 ILE n 
1 12 CYS n 
1 13 ASP n 
1 14 LYS n 
1 15 ILE n 
1 16 PHE n 
1 17 PRO n 
1 18 ALA n 
1 19 THR n 
1 20 GLU n 
1 21 LYS n 
1 22 GLN n 
1 23 ILE n 
1 24 PHE n 
1 25 GLU n 
1 26 ASP n 
1 27 HIS n 
1 28 VAL n 
1 29 PHE n 
1 30 CYS n 
1 31 HIS n 
1 32 SER n 
1 33 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CALCOCO2, NDP52' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET32a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLN 1  49 49 GLN GLN A . n 
A 1 2  MET 2  50 50 MET MET A . n 
A 1 3  GLN 3  51 51 GLN GLN A . n 
A 1 4  PRO 4  52 52 PRO PRO A . n 
A 1 5  LEU 5  53 53 LEU LEU A . n 
A 1 6  CYS 6  54 54 CYS CYS A . n 
A 1 7  PHE 7  55 55 PHE PHE A . n 
A 1 8  ASN 8  56 56 ASN ASN A . n 
A 1 9  CYS 9  57 57 CYS CYS A . n 
A 1 10 PRO 10 58 58 PRO PRO A . n 
A 1 11 ILE 11 59 59 ILE ILE A . n 
A 1 12 CYS 12 60 60 CYS CYS A . n 
A 1 13 ASP 13 61 61 ASP ASP A . n 
A 1 14 LYS 14 62 62 LYS LYS A . n 
A 1 15 ILE 15 63 63 ILE ILE A . n 
A 1 16 PHE 16 64 64 PHE PHE A . n 
A 1 17 PRO 17 65 65 PRO PRO A . n 
A 1 18 ALA 18 66 66 ALA ALA A . n 
A 1 19 THR 19 67 67 THR THR A . n 
A 1 20 GLU 20 68 68 GLU GLU A . n 
A 1 21 LYS 21 69 69 LYS LYS A . n 
A 1 22 GLN 22 70 70 GLN GLN A . n 
A 1 23 ILE 23 71 71 ILE ILE A . n 
A 1 24 PHE 24 72 72 PHE PHE A . n 
A 1 25 GLU 25 73 73 GLU GLU A . n 
A 1 26 ASP 26 74 74 ASP ASP A . n 
A 1 27 HIS 27 75 75 HIS HIS A . n 
A 1 28 VAL 28 76 76 VAL VAL A . n 
A 1 29 PHE 29 77 77 PHE PHE A . n 
A 1 30 CYS 30 78 78 CYS CYS A . n 
A 1 31 HIS 31 79 79 HIS HIS A . n 
A 1 32 SER 32 80 80 SER SER A . n 
A 1 33 LEU 33 81 81 LEU LEU A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          ZN 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     101 
_pdbx_nonpoly_scheme.auth_seq_num    82 
_pdbx_nonpoly_scheme.pdb_mon_id      ZN 
_pdbx_nonpoly_scheme.auth_mon_id     ZN2 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2MXP 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2MXP 
_struct.title                     'Solution structure of NDP52 ubiquitin-binding zinc finger' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MXP 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'zinc finger, NDP52, ubiquitin-binding, C2H2-type, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CACO2_HUMAN 
_struct_ref.pdbx_db_accession          Q13137 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   QMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL 
_struct_ref.pdbx_align_begin           414 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2MXP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 33 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q13137 
_struct_ref_seq.db_align_beg                  414 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  446 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       49 
_struct_ref_seq.pdbx_auth_seq_align_end       81 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       GLU 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        20 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       SER 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        32 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLU 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         68 
_struct_conf.end_auth_comp_id        SER 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         80 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 9  SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 57 A ZN 101 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc2 metalc ? ? A CYS 12 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 60 A ZN 101 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc3 metalc ? ? A HIS 27 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 75 A ZN 101 1_555 ? ? ? ? ? ? ? 1.969 ? ? 
metalc4 metalc ? ? A HIS 31 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 79 A ZN 101 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG  ? A CYS 9  ? A CYS 57 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG  ? A CYS 12 ? A CYS 60 ? 1_555 121.1 ? 
2 SG  ? A CYS 9  ? A CYS 57 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 27 ? A HIS 75 ? 1_555 102.2 ? 
3 SG  ? A CYS 12 ? A CYS 60 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 27 ? A HIS 75 ? 1_555 107.7 ? 
4 SG  ? A CYS 9  ? A CYS 57 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 31 ? A HIS 79 ? 1_555 108.3 ? 
5 SG  ? A CYS 12 ? A CYS 60 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 31 ? A HIS 79 ? 1_555 116.6 ? 
6 NE2 ? A HIS 27 ? A HIS 75 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 31 ? A HIS 79 ? 1_555 97.0  ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 6  ? ASN A 8  ? CYS A 54 ASN A 56 
A 2 ILE A 15 ? PRO A 17 ? ILE A 63 PRO A 65 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   PHE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    7 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    PHE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     55 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   PHE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    16 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    PHE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     64 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    ZN 
_struct_site.pdbx_auth_seq_id     101 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 9  ? CYS A 57 . ? 1_555 ? 
2 AC1 4 CYS A 12 ? CYS A 60 . ? 1_555 ? 
3 AC1 4 HIS A 27 ? HIS A 75 . ? 1_555 ? 
4 AC1 4 HIS A 31 ? HIS A 79 . ? 1_555 ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  GLN A 51 ? ? 61.09   112.32  
2  1  PRO A 52 ? ? -62.06  74.26   
3  1  CYS A 54 ? ? -177.67 140.94  
4  1  ASP A 61 ? ? 86.59   19.38   
5  2  MET A 50 ? ? 62.24   150.21  
6  2  PRO A 52 ? ? -54.30  174.64  
7  2  CYS A 54 ? ? 177.68  147.36  
8  2  ASP A 61 ? ? 82.14   24.76   
9  2  GLU A 68 ? ? -97.88  33.07   
10 3  MET A 50 ? ? -165.50 -46.57  
11 3  CYS A 54 ? ? 178.17  -174.26 
12 3  ASP A 61 ? ? 80.10   36.92   
13 4  CYS A 54 ? ? 176.81  141.28  
14 4  ASP A 61 ? ? 78.18   38.67   
15 5  ASP A 61 ? ? 153.86  -37.94  
16 5  LYS A 62 ? ? -31.20  127.54  
17 5  GLU A 68 ? ? -98.92  35.13   
18 6  CYS A 54 ? ? 179.47  -179.14 
19 6  ASP A 61 ? ? 153.11  -37.93  
20 6  LYS A 62 ? ? -30.72  126.32  
21 6  GLU A 68 ? ? -97.45  33.21   
22 7  PRO A 52 ? ? -69.59  76.21   
23 7  CYS A 54 ? ? -170.32 -173.28 
24 7  ASP A 61 ? ? 82.45   17.53   
25 7  LYS A 62 ? ? -59.27  171.38  
26 8  CYS A 54 ? ? -172.85 140.86  
27 8  ASP A 61 ? ? 78.94   38.09   
28 9  MET A 50 ? ? -103.34 74.47   
29 9  LEU A 53 ? ? 74.40   32.36   
30 9  ASP A 61 ? ? 86.79   13.68   
31 10 GLN A 51 ? ? -153.81 85.24   
32 10 PRO A 52 ? ? -54.31  -170.20 
33 10 CYS A 54 ? ? 175.76  -175.50 
34 10 ASP A 61 ? ? 76.67   39.67   
35 11 MET A 50 ? ? -177.11 -39.42  
36 11 GLN A 51 ? ? 60.64   69.89   
37 11 PRO A 52 ? ? -56.41  171.96  
38 11 ASP A 61 ? ? 96.52   7.89    
39 12 MET A 50 ? ? -176.97 -52.02  
40 12 GLN A 51 ? ? 61.82   147.02  
41 12 CYS A 54 ? ? 171.62  -175.63 
42 12 ASP A 61 ? ? 85.46   12.60   
43 12 GLU A 68 ? ? -99.41  35.52   
44 13 MET A 50 ? ? 59.98   97.87   
45 13 PRO A 52 ? ? -67.81  76.99   
46 13 CYS A 54 ? ? -176.44 139.06  
47 13 ASP A 61 ? ? 84.51   33.90   
48 13 GLU A 68 ? ? -97.63  32.43   
49 14 MET A 50 ? ? -160.35 -66.44  
50 14 GLN A 51 ? ? -48.90  102.56  
51 15 MET A 50 ? ? 59.59   81.60   
52 15 PRO A 52 ? ? -63.00  -177.94 
53 15 CYS A 54 ? ? -175.27 -173.24 
54 15 ASP A 61 ? ? 82.56   24.59   
55 16 PRO A 52 ? ? -65.09  67.73   
56 16 CYS A 54 ? ? -170.73 -173.25 
57 16 ILE A 59 ? ? -127.26 -53.69  
58 16 ASP A 61 ? ? 83.14   11.87   
59 16 LYS A 62 ? ? -58.71  177.04  
60 16 GLU A 68 ? ? -100.00 32.73   
61 17 GLN A 51 ? ? 61.41   110.70  
62 17 ASP A 61 ? ? 77.15   35.16   
63 17 GLU A 68 ? ? -98.49  34.63   
64 18 CYS A 54 ? ? -172.17 -179.95 
65 18 ILE A 59 ? ? -128.12 -53.33  
66 18 ASP A 61 ? ? 88.13   9.84    
67 18 GLU A 68 ? ? -96.47  31.94   
68 19 PRO A 52 ? ? -53.02  174.87  
69 19 CYS A 54 ? ? -177.86 -173.27 
70 19 ASP A 61 ? ? 88.84   23.83   
71 20 MET A 50 ? ? 46.30   -170.20 
72 20 PRO A 52 ? ? -54.94  -173.86 
73 20 ASP A 61 ? ? 152.72  -38.24  
74 20 LYS A 62 ? ? -30.03  129.65  
75 20 GLU A 68 ? ? -98.43  30.15   
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2MXP 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2MXP 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1 mM [U-100% 13C; U-100% 15N] entity_1-1, 1 mM [U-100% 15N] entity_1-2, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' 
'1 mM [U-100% 13C; U-100% 15N] entity_1-3, 100% D2O'                                      2 '100% D2O'        
'1.2 mM entity_1-4, 100% D2O'                                                             3 '100% D2O'        
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
entity_1-1 1   ? mM '[U-100% 13C; U-100% 15N]' 1 
entity_1-2 1   ? mM '[U-100% 15N]'             1 
entity_1-3 1   ? mM '[U-100% 13C; U-100% 15N]' 2 
entity_1-4 1.2 ? mM ?                          3 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 0.1 6.5 ambient atm 298 K 
2 0.1 6.5 ambient atm 298 K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D CBCA(CO)NH'             
1 2 1 '3D HNCACB'                 
1 3 1 '3D 1H-15N NOESY'           
1 4 1 '2D 1H-13C HSQC'            
2 5 2 '3D HCCH-TOCSY'             
2 6 2 '3D 1H-13C NOESY aliphatic' 
2 7 3 '2D 1H-1H NOESY'            
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        ? 
_pdbx_nmr_constraints.entry_id                                      2MXP 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         793 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  252 
_pdbx_nmr_constraints.NOE_long_range_total_count                    176 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  159 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    206 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   35 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     17 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     18 
# 
_pdbx_nmr_refine.entry_id           2MXP 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe 1 ? 
Garrett                                             'chemical shift assignment' PIPP    2 ? 
Garrett                                             'data analysis'             PIPP    3 ? 
Goddard                                             'data analysis'             Sparky  4 ? 
Goddard                                             'chemical shift assignment' Sparky  5 ? 
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution'        CNS     6 ? 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement                  CNS     7 ? 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ASN N    N  N N 14  
ASN CA   C  N S 15  
ASN C    C  N N 16  
ASN O    O  N N 17  
ASN CB   C  N N 18  
ASN CG   C  N N 19  
ASN OD1  O  N N 20  
ASN ND2  N  N N 21  
ASN OXT  O  N N 22  
ASN H    H  N N 23  
ASN H2   H  N N 24  
ASN HA   H  N N 25  
ASN HB2  H  N N 26  
ASN HB3  H  N N 27  
ASN HD21 H  N N 28  
ASN HD22 H  N N 29  
ASN HXT  H  N N 30  
ASP N    N  N N 31  
ASP CA   C  N S 32  
ASP C    C  N N 33  
ASP O    O  N N 34  
ASP CB   C  N N 35  
ASP CG   C  N N 36  
ASP OD1  O  N N 37  
ASP OD2  O  N N 38  
ASP OXT  O  N N 39  
ASP H    H  N N 40  
ASP H2   H  N N 41  
ASP HA   H  N N 42  
ASP HB2  H  N N 43  
ASP HB3  H  N N 44  
ASP HD2  H  N N 45  
ASP HXT  H  N N 46  
CYS N    N  N N 47  
CYS CA   C  N R 48  
CYS C    C  N N 49  
CYS O    O  N N 50  
CYS CB   C  N N 51  
CYS SG   S  N N 52  
CYS OXT  O  N N 53  
CYS H    H  N N 54  
CYS H2   H  N N 55  
CYS HA   H  N N 56  
CYS HB2  H  N N 57  
CYS HB3  H  N N 58  
CYS HG   H  N N 59  
CYS HXT  H  N N 60  
GLN N    N  N N 61  
GLN CA   C  N S 62  
GLN C    C  N N 63  
GLN O    O  N N 64  
GLN CB   C  N N 65  
GLN CG   C  N N 66  
GLN CD   C  N N 67  
GLN OE1  O  N N 68  
GLN NE2  N  N N 69  
GLN OXT  O  N N 70  
GLN H    H  N N 71  
GLN H2   H  N N 72  
GLN HA   H  N N 73  
GLN HB2  H  N N 74  
GLN HB3  H  N N 75  
GLN HG2  H  N N 76  
GLN HG3  H  N N 77  
GLN HE21 H  N N 78  
GLN HE22 H  N N 79  
GLN HXT  H  N N 80  
GLU N    N  N N 81  
GLU CA   C  N S 82  
GLU C    C  N N 83  
GLU O    O  N N 84  
GLU CB   C  N N 85  
GLU CG   C  N N 86  
GLU CD   C  N N 87  
GLU OE1  O  N N 88  
GLU OE2  O  N N 89  
GLU OXT  O  N N 90  
GLU H    H  N N 91  
GLU H2   H  N N 92  
GLU HA   H  N N 93  
GLU HB2  H  N N 94  
GLU HB3  H  N N 95  
GLU HG2  H  N N 96  
GLU HG3  H  N N 97  
GLU HE2  H  N N 98  
GLU HXT  H  N N 99  
HIS N    N  N N 100 
HIS CA   C  N S 101 
HIS C    C  N N 102 
HIS O    O  N N 103 
HIS CB   C  N N 104 
HIS CG   C  Y N 105 
HIS ND1  N  Y N 106 
HIS CD2  C  Y N 107 
HIS CE1  C  Y N 108 
HIS NE2  N  Y N 109 
HIS OXT  O  N N 110 
HIS H    H  N N 111 
HIS H2   H  N N 112 
HIS HA   H  N N 113 
HIS HB2  H  N N 114 
HIS HB3  H  N N 115 
HIS HD1  H  N N 116 
HIS HD2  H  N N 117 
HIS HE1  H  N N 118 
HIS HE2  H  N N 119 
HIS HXT  H  N N 120 
ILE N    N  N N 121 
ILE CA   C  N S 122 
ILE C    C  N N 123 
ILE O    O  N N 124 
ILE CB   C  N S 125 
ILE CG1  C  N N 126 
ILE CG2  C  N N 127 
ILE CD1  C  N N 128 
ILE OXT  O  N N 129 
ILE H    H  N N 130 
ILE H2   H  N N 131 
ILE HA   H  N N 132 
ILE HB   H  N N 133 
ILE HG12 H  N N 134 
ILE HG13 H  N N 135 
ILE HG21 H  N N 136 
ILE HG22 H  N N 137 
ILE HG23 H  N N 138 
ILE HD11 H  N N 139 
ILE HD12 H  N N 140 
ILE HD13 H  N N 141 
ILE HXT  H  N N 142 
LEU N    N  N N 143 
LEU CA   C  N S 144 
LEU C    C  N N 145 
LEU O    O  N N 146 
LEU CB   C  N N 147 
LEU CG   C  N N 148 
LEU CD1  C  N N 149 
LEU CD2  C  N N 150 
LEU OXT  O  N N 151 
LEU H    H  N N 152 
LEU H2   H  N N 153 
LEU HA   H  N N 154 
LEU HB2  H  N N 155 
LEU HB3  H  N N 156 
LEU HG   H  N N 157 
LEU HD11 H  N N 158 
LEU HD12 H  N N 159 
LEU HD13 H  N N 160 
LEU HD21 H  N N 161 
LEU HD22 H  N N 162 
LEU HD23 H  N N 163 
LEU HXT  H  N N 164 
LYS N    N  N N 165 
LYS CA   C  N S 166 
LYS C    C  N N 167 
LYS O    O  N N 168 
LYS CB   C  N N 169 
LYS CG   C  N N 170 
LYS CD   C  N N 171 
LYS CE   C  N N 172 
LYS NZ   N  N N 173 
LYS OXT  O  N N 174 
LYS H    H  N N 175 
LYS H2   H  N N 176 
LYS HA   H  N N 177 
LYS HB2  H  N N 178 
LYS HB3  H  N N 179 
LYS HG2  H  N N 180 
LYS HG3  H  N N 181 
LYS HD2  H  N N 182 
LYS HD3  H  N N 183 
LYS HE2  H  N N 184 
LYS HE3  H  N N 185 
LYS HZ1  H  N N 186 
LYS HZ2  H  N N 187 
LYS HZ3  H  N N 188 
LYS HXT  H  N N 189 
MET N    N  N N 190 
MET CA   C  N S 191 
MET C    C  N N 192 
MET O    O  N N 193 
MET CB   C  N N 194 
MET CG   C  N N 195 
MET SD   S  N N 196 
MET CE   C  N N 197 
MET OXT  O  N N 198 
MET H    H  N N 199 
MET H2   H  N N 200 
MET HA   H  N N 201 
MET HB2  H  N N 202 
MET HB3  H  N N 203 
MET HG2  H  N N 204 
MET HG3  H  N N 205 
MET HE1  H  N N 206 
MET HE2  H  N N 207 
MET HE3  H  N N 208 
MET HXT  H  N N 209 
PHE N    N  N N 210 
PHE CA   C  N S 211 
PHE C    C  N N 212 
PHE O    O  N N 213 
PHE CB   C  N N 214 
PHE CG   C  Y N 215 
PHE CD1  C  Y N 216 
PHE CD2  C  Y N 217 
PHE CE1  C  Y N 218 
PHE CE2  C  Y N 219 
PHE CZ   C  Y N 220 
PHE OXT  O  N N 221 
PHE H    H  N N 222 
PHE H2   H  N N 223 
PHE HA   H  N N 224 
PHE HB2  H  N N 225 
PHE HB3  H  N N 226 
PHE HD1  H  N N 227 
PHE HD2  H  N N 228 
PHE HE1  H  N N 229 
PHE HE2  H  N N 230 
PHE HZ   H  N N 231 
PHE HXT  H  N N 232 
PRO N    N  N N 233 
PRO CA   C  N S 234 
PRO C    C  N N 235 
PRO O    O  N N 236 
PRO CB   C  N N 237 
PRO CG   C  N N 238 
PRO CD   C  N N 239 
PRO OXT  O  N N 240 
PRO H    H  N N 241 
PRO HA   H  N N 242 
PRO HB2  H  N N 243 
PRO HB3  H  N N 244 
PRO HG2  H  N N 245 
PRO HG3  H  N N 246 
PRO HD2  H  N N 247 
PRO HD3  H  N N 248 
PRO HXT  H  N N 249 
SER N    N  N N 250 
SER CA   C  N S 251 
SER C    C  N N 252 
SER O    O  N N 253 
SER CB   C  N N 254 
SER OG   O  N N 255 
SER OXT  O  N N 256 
SER H    H  N N 257 
SER H2   H  N N 258 
SER HA   H  N N 259 
SER HB2  H  N N 260 
SER HB3  H  N N 261 
SER HG   H  N N 262 
SER HXT  H  N N 263 
THR N    N  N N 264 
THR CA   C  N S 265 
THR C    C  N N 266 
THR O    O  N N 267 
THR CB   C  N R 268 
THR OG1  O  N N 269 
THR CG2  C  N N 270 
THR OXT  O  N N 271 
THR H    H  N N 272 
THR H2   H  N N 273 
THR HA   H  N N 274 
THR HB   H  N N 275 
THR HG1  H  N N 276 
THR HG21 H  N N 277 
THR HG22 H  N N 278 
THR HG23 H  N N 279 
THR HXT  H  N N 280 
VAL N    N  N N 281 
VAL CA   C  N S 282 
VAL C    C  N N 283 
VAL O    O  N N 284 
VAL CB   C  N N 285 
VAL CG1  C  N N 286 
VAL CG2  C  N N 287 
VAL OXT  O  N N 288 
VAL H    H  N N 289 
VAL H2   H  N N 290 
VAL HA   H  N N 291 
VAL HB   H  N N 292 
VAL HG11 H  N N 293 
VAL HG12 H  N N 294 
VAL HG13 H  N N 295 
VAL HG21 H  N N 296 
VAL HG22 H  N N 297 
VAL HG23 H  N N 298 
VAL HXT  H  N N 299 
ZN  ZN   ZN N N 300 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ASN N   CA   sing N N 13  
ASN N   H    sing N N 14  
ASN N   H2   sing N N 15  
ASN CA  C    sing N N 16  
ASN CA  CB   sing N N 17  
ASN CA  HA   sing N N 18  
ASN C   O    doub N N 19  
ASN C   OXT  sing N N 20  
ASN CB  CG   sing N N 21  
ASN CB  HB2  sing N N 22  
ASN CB  HB3  sing N N 23  
ASN CG  OD1  doub N N 24  
ASN CG  ND2  sing N N 25  
ASN ND2 HD21 sing N N 26  
ASN ND2 HD22 sing N N 27  
ASN OXT HXT  sing N N 28  
ASP N   CA   sing N N 29  
ASP N   H    sing N N 30  
ASP N   H2   sing N N 31  
ASP CA  C    sing N N 32  
ASP CA  CB   sing N N 33  
ASP CA  HA   sing N N 34  
ASP C   O    doub N N 35  
ASP C   OXT  sing N N 36  
ASP CB  CG   sing N N 37  
ASP CB  HB2  sing N N 38  
ASP CB  HB3  sing N N 39  
ASP CG  OD1  doub N N 40  
ASP CG  OD2  sing N N 41  
ASP OD2 HD2  sing N N 42  
ASP OXT HXT  sing N N 43  
CYS N   CA   sing N N 44  
CYS N   H    sing N N 45  
CYS N   H2   sing N N 46  
CYS CA  C    sing N N 47  
CYS CA  CB   sing N N 48  
CYS CA  HA   sing N N 49  
CYS C   O    doub N N 50  
CYS C   OXT  sing N N 51  
CYS CB  SG   sing N N 52  
CYS CB  HB2  sing N N 53  
CYS CB  HB3  sing N N 54  
CYS SG  HG   sing N N 55  
CYS OXT HXT  sing N N 56  
GLN N   CA   sing N N 57  
GLN N   H    sing N N 58  
GLN N   H2   sing N N 59  
GLN CA  C    sing N N 60  
GLN CA  CB   sing N N 61  
GLN CA  HA   sing N N 62  
GLN C   O    doub N N 63  
GLN C   OXT  sing N N 64  
GLN CB  CG   sing N N 65  
GLN CB  HB2  sing N N 66  
GLN CB  HB3  sing N N 67  
GLN CG  CD   sing N N 68  
GLN CG  HG2  sing N N 69  
GLN CG  HG3  sing N N 70  
GLN CD  OE1  doub N N 71  
GLN CD  NE2  sing N N 72  
GLN NE2 HE21 sing N N 73  
GLN NE2 HE22 sing N N 74  
GLN OXT HXT  sing N N 75  
GLU N   CA   sing N N 76  
GLU N   H    sing N N 77  
GLU N   H2   sing N N 78  
GLU CA  C    sing N N 79  
GLU CA  CB   sing N N 80  
GLU CA  HA   sing N N 81  
GLU C   O    doub N N 82  
GLU C   OXT  sing N N 83  
GLU CB  CG   sing N N 84  
GLU CB  HB2  sing N N 85  
GLU CB  HB3  sing N N 86  
GLU CG  CD   sing N N 87  
GLU CG  HG2  sing N N 88  
GLU CG  HG3  sing N N 89  
GLU CD  OE1  doub N N 90  
GLU CD  OE2  sing N N 91  
GLU OE2 HE2  sing N N 92  
GLU OXT HXT  sing N N 93  
HIS N   CA   sing N N 94  
HIS N   H    sing N N 95  
HIS N   H2   sing N N 96  
HIS CA  C    sing N N 97  
HIS CA  CB   sing N N 98  
HIS CA  HA   sing N N 99  
HIS C   O    doub N N 100 
HIS C   OXT  sing N N 101 
HIS CB  CG   sing N N 102 
HIS CB  HB2  sing N N 103 
HIS CB  HB3  sing N N 104 
HIS CG  ND1  sing Y N 105 
HIS CG  CD2  doub Y N 106 
HIS ND1 CE1  doub Y N 107 
HIS ND1 HD1  sing N N 108 
HIS CD2 NE2  sing Y N 109 
HIS CD2 HD2  sing N N 110 
HIS CE1 NE2  sing Y N 111 
HIS CE1 HE1  sing N N 112 
HIS NE2 HE2  sing N N 113 
HIS OXT HXT  sing N N 114 
ILE N   CA   sing N N 115 
ILE N   H    sing N N 116 
ILE N   H2   sing N N 117 
ILE CA  C    sing N N 118 
ILE CA  CB   sing N N 119 
ILE CA  HA   sing N N 120 
ILE C   O    doub N N 121 
ILE C   OXT  sing N N 122 
ILE CB  CG1  sing N N 123 
ILE CB  CG2  sing N N 124 
ILE CB  HB   sing N N 125 
ILE CG1 CD1  sing N N 126 
ILE CG1 HG12 sing N N 127 
ILE CG1 HG13 sing N N 128 
ILE CG2 HG21 sing N N 129 
ILE CG2 HG22 sing N N 130 
ILE CG2 HG23 sing N N 131 
ILE CD1 HD11 sing N N 132 
ILE CD1 HD12 sing N N 133 
ILE CD1 HD13 sing N N 134 
ILE OXT HXT  sing N N 135 
LEU N   CA   sing N N 136 
LEU N   H    sing N N 137 
LEU N   H2   sing N N 138 
LEU CA  C    sing N N 139 
LEU CA  CB   sing N N 140 
LEU CA  HA   sing N N 141 
LEU C   O    doub N N 142 
LEU C   OXT  sing N N 143 
LEU CB  CG   sing N N 144 
LEU CB  HB2  sing N N 145 
LEU CB  HB3  sing N N 146 
LEU CG  CD1  sing N N 147 
LEU CG  CD2  sing N N 148 
LEU CG  HG   sing N N 149 
LEU CD1 HD11 sing N N 150 
LEU CD1 HD12 sing N N 151 
LEU CD1 HD13 sing N N 152 
LEU CD2 HD21 sing N N 153 
LEU CD2 HD22 sing N N 154 
LEU CD2 HD23 sing N N 155 
LEU OXT HXT  sing N N 156 
LYS N   CA   sing N N 157 
LYS N   H    sing N N 158 
LYS N   H2   sing N N 159 
LYS CA  C    sing N N 160 
LYS CA  CB   sing N N 161 
LYS CA  HA   sing N N 162 
LYS C   O    doub N N 163 
LYS C   OXT  sing N N 164 
LYS CB  CG   sing N N 165 
LYS CB  HB2  sing N N 166 
LYS CB  HB3  sing N N 167 
LYS CG  CD   sing N N 168 
LYS CG  HG2  sing N N 169 
LYS CG  HG3  sing N N 170 
LYS CD  CE   sing N N 171 
LYS CD  HD2  sing N N 172 
LYS CD  HD3  sing N N 173 
LYS CE  NZ   sing N N 174 
LYS CE  HE2  sing N N 175 
LYS CE  HE3  sing N N 176 
LYS NZ  HZ1  sing N N 177 
LYS NZ  HZ2  sing N N 178 
LYS NZ  HZ3  sing N N 179 
LYS OXT HXT  sing N N 180 
MET N   CA   sing N N 181 
MET N   H    sing N N 182 
MET N   H2   sing N N 183 
MET CA  C    sing N N 184 
MET CA  CB   sing N N 185 
MET CA  HA   sing N N 186 
MET C   O    doub N N 187 
MET C   OXT  sing N N 188 
MET CB  CG   sing N N 189 
MET CB  HB2  sing N N 190 
MET CB  HB3  sing N N 191 
MET CG  SD   sing N N 192 
MET CG  HG2  sing N N 193 
MET CG  HG3  sing N N 194 
MET SD  CE   sing N N 195 
MET CE  HE1  sing N N 196 
MET CE  HE2  sing N N 197 
MET CE  HE3  sing N N 198 
MET OXT HXT  sing N N 199 
PHE N   CA   sing N N 200 
PHE N   H    sing N N 201 
PHE N   H2   sing N N 202 
PHE CA  C    sing N N 203 
PHE CA  CB   sing N N 204 
PHE CA  HA   sing N N 205 
PHE C   O    doub N N 206 
PHE C   OXT  sing N N 207 
PHE CB  CG   sing N N 208 
PHE CB  HB2  sing N N 209 
PHE CB  HB3  sing N N 210 
PHE CG  CD1  doub Y N 211 
PHE CG  CD2  sing Y N 212 
PHE CD1 CE1  sing Y N 213 
PHE CD1 HD1  sing N N 214 
PHE CD2 CE2  doub Y N 215 
PHE CD2 HD2  sing N N 216 
PHE CE1 CZ   doub Y N 217 
PHE CE1 HE1  sing N N 218 
PHE CE2 CZ   sing Y N 219 
PHE CE2 HE2  sing N N 220 
PHE CZ  HZ   sing N N 221 
PHE OXT HXT  sing N N 222 
PRO N   CA   sing N N 223 
PRO N   CD   sing N N 224 
PRO N   H    sing N N 225 
PRO CA  C    sing N N 226 
PRO CA  CB   sing N N 227 
PRO CA  HA   sing N N 228 
PRO C   O    doub N N 229 
PRO C   OXT  sing N N 230 
PRO CB  CG   sing N N 231 
PRO CB  HB2  sing N N 232 
PRO CB  HB3  sing N N 233 
PRO CG  CD   sing N N 234 
PRO CG  HG2  sing N N 235 
PRO CG  HG3  sing N N 236 
PRO CD  HD2  sing N N 237 
PRO CD  HD3  sing N N 238 
PRO OXT HXT  sing N N 239 
SER N   CA   sing N N 240 
SER N   H    sing N N 241 
SER N   H2   sing N N 242 
SER CA  C    sing N N 243 
SER CA  CB   sing N N 244 
SER CA  HA   sing N N 245 
SER C   O    doub N N 246 
SER C   OXT  sing N N 247 
SER CB  OG   sing N N 248 
SER CB  HB2  sing N N 249 
SER CB  HB3  sing N N 250 
SER OG  HG   sing N N 251 
SER OXT HXT  sing N N 252 
THR N   CA   sing N N 253 
THR N   H    sing N N 254 
THR N   H2   sing N N 255 
THR CA  C    sing N N 256 
THR CA  CB   sing N N 257 
THR CA  HA   sing N N 258 
THR C   O    doub N N 259 
THR C   OXT  sing N N 260 
THR CB  OG1  sing N N 261 
THR CB  CG2  sing N N 262 
THR CB  HB   sing N N 263 
THR OG1 HG1  sing N N 264 
THR CG2 HG21 sing N N 265 
THR CG2 HG22 sing N N 266 
THR CG2 HG23 sing N N 267 
THR OXT HXT  sing N N 268 
VAL N   CA   sing N N 269 
VAL N   H    sing N N 270 
VAL N   H2   sing N N 271 
VAL CA  C    sing N N 272 
VAL CA  CB   sing N N 273 
VAL CA  HA   sing N N 274 
VAL C   O    doub N N 275 
VAL C   OXT  sing N N 276 
VAL CB  CG1  sing N N 277 
VAL CB  CG2  sing N N 278 
VAL CB  HB   sing N N 279 
VAL CG1 HG11 sing N N 280 
VAL CG1 HG12 sing N N 281 
VAL CG1 HG13 sing N N 282 
VAL CG2 HG21 sing N N 283 
VAL CG2 HG22 sing N N 284 
VAL CG2 HG23 sing N N 285 
VAL OXT HXT  sing N N 286 
# 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.manufacturer      Agilent 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Agilent INOVA' 
# 
_atom_sites.entry_id                    2MXP 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_