data_2MY9 # _entry.id 2MY9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id RCSB104194 RCSB 2MY9 PDB 25448 BMRB D_1000104194 WWPDB # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2lkt PDB 'Solution structure of N-terminal domain of human TIG3 in 2 M UREA' unspecified 25448 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MY9 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-01-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wei, H.' 1 'Wang, L.' 2 'Xia, B.' 3 # _citation.id primary _citation.title 'Structural and functional characterization of tumor suppressors TIG3 and H-REV107.' _citation.journal_abbrev 'Febs Lett.' _citation.journal_volume 589 _citation.page_first 1179 _citation.page_last 1186 _citation.year 2015 _citation.journal_id_ASTM FEBLAL _citation.country NE _citation.journal_id_ISSN 0014-5793 _citation.journal_id_CSD 0165 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25871522 _citation.pdbx_database_id_DOI 10.1016/j.febslet.2015.04.002 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Wei, H.' 1 primary 'Wang, L.' 2 primary 'Ren, X.' 3 primary 'Yu, W.' 4 primary 'Lin, J.' 5 primary 'Jin, C.' 6 primary 'Xia, B.' 7 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Retinoic acid receptor responder protein 3' _entity.formula_weight 14050.886 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.1.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain (UNP residues 1-125)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HRAS-like suppressor 4, HRSL4, RAR-responsive protein TIG3, Retinoid-inducible gene 1 protein, Tazarotene-induced gene 3 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSL DHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKS ; _entity_poly.pdbx_seq_one_letter_code_can ;MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSL DHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 PRO n 1 5 HIS n 1 6 GLN n 1 7 GLU n 1 8 PRO n 1 9 LYS n 1 10 PRO n 1 11 GLY n 1 12 ASP n 1 13 LEU n 1 14 ILE n 1 15 GLU n 1 16 ILE n 1 17 PHE n 1 18 ARG n 1 19 LEU n 1 20 GLY n 1 21 TYR n 1 22 GLU n 1 23 HIS n 1 24 TRP n 1 25 ALA n 1 26 LEU n 1 27 TYR n 1 28 ILE n 1 29 GLY n 1 30 ASP n 1 31 GLY n 1 32 TYR n 1 33 VAL n 1 34 ILE n 1 35 HIS n 1 36 LEU n 1 37 ALA n 1 38 PRO n 1 39 PRO n 1 40 SER n 1 41 GLU n 1 42 TYR n 1 43 PRO n 1 44 GLY n 1 45 ALA n 1 46 GLY n 1 47 SER n 1 48 SER n 1 49 SER n 1 50 VAL n 1 51 PHE n 1 52 SER n 1 53 VAL n 1 54 LEU n 1 55 SER n 1 56 ASN n 1 57 SER n 1 58 ALA n 1 59 GLU n 1 60 VAL n 1 61 LYS n 1 62 ARG n 1 63 GLU n 1 64 ARG n 1 65 LEU n 1 66 GLU n 1 67 ASP n 1 68 VAL n 1 69 VAL n 1 70 GLY n 1 71 GLY n 1 72 CYS n 1 73 CYS n 1 74 TYR n 1 75 ARG n 1 76 VAL n 1 77 ASN n 1 78 ASN n 1 79 SER n 1 80 LEU n 1 81 ASP n 1 82 HIS n 1 83 GLU n 1 84 TYR n 1 85 GLN n 1 86 PRO n 1 87 ARG n 1 88 PRO n 1 89 VAL n 1 90 GLU n 1 91 VAL n 1 92 ILE n 1 93 ILE n 1 94 SER n 1 95 SER n 1 96 ALA n 1 97 LYS n 1 98 GLU n 1 99 MET n 1 100 VAL n 1 101 GLY n 1 102 GLN n 1 103 LYS n 1 104 MET n 1 105 LYS n 1 106 TYR n 1 107 SER n 1 108 ILE n 1 109 VAL n 1 110 SER n 1 111 ARG n 1 112 ASN n 1 113 CYS n 1 114 GLU n 1 115 HIS n 1 116 PHE n 1 117 VAL n 1 118 THR n 1 119 GLN n 1 120 LEU n 1 121 ARG n 1 122 TYR n 1 123 GLY n 1 124 LYS n 1 125 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RARRES3, RIG1, TIG3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Rosetta _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HRSL4_HUMAN _struct_ref.pdbx_db_accession Q9UL19 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSL DHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MY9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UL19 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCA' 1 5 1 '3D HNCACB' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 1 '3D HCCH-COSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.5 mM [U-13C; U-15N] TIG3N, 0.03% DSS, 20 mM DTT, 50 mM sodium chloride, 50 mM potassium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker Avance 1 'Bruker Avance' 500 Bruker Avance 2 'Bruker Avance' 600 Bruker Avance 3 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MY9 _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MY9 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MY9 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement AMBER 9.0 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 2 'Guntert, Braun and Wuthrich' 'structure solution' DYANA 3.0 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw ? 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 'Johnson, One Moon Scientific' 'data analysis' NMRView 5 6 'Laskowski and MacArthur' 'data analysis' ProcheckNMR ? 7 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS ? 8 'Duggan, Legge, Dyson & Wright' 'chemical shift assignment' SANE ? 9 'Bruker Biospin' collection TOPSPIN 3.0 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MY9 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MY9 _struct.title 'Solution structure of N-terminal domain of human TIG3' _struct.pdbx_descriptor 'Retinoic acid receptor responder protein 3 (E.C.3.1.1.-)' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MY9 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'TIG3, H-REV107 family, NlpC/P60, phospholipase, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 41 ? ALA A 45 ? GLU A 41 ALA A 45 5 ? 5 HELX_P HELX_P2 2 LEU A 65 ? GLY A 70 ? LEU A 65 GLY A 70 1 ? 6 HELX_P HELX_P3 3 ASN A 78 ? GLU A 83 ? ASN A 78 GLU A 83 5 ? 6 HELX_P HELX_P4 4 PRO A 88 ? VAL A 100 ? PRO A 88 VAL A 100 1 ? 13 HELX_P HELX_P5 5 TYR A 106 ? SER A 110 ? TYR A 106 SER A 110 5 ? 5 HELX_P HELX_P6 6 ASN A 112 ? GLY A 123 ? ASN A 112 GLY A 123 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 73 ? VAL A 76 ? CYS A 73 VAL A 76 A 2 LEU A 13 ? PHE A 17 ? LEU A 13 PHE A 17 A 3 GLU A 22 ? GLY A 29 ? GLU A 22 GLY A 29 A 4 TYR A 32 ? ALA A 37 ? TYR A 32 ALA A 37 A 5 ALA A 58 ? ARG A 64 ? ALA A 58 ARG A 64 A 6 LYS A 103 ? MET A 104 ? LYS A 103 MET A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 75 ? O ARG A 75 N GLU A 15 ? N GLU A 15 A 2 3 N ILE A 16 ? N ILE A 16 O HIS A 23 ? O HIS A 23 A 3 4 N LEU A 26 ? N LEU A 26 O ILE A 34 ? O ILE A 34 A 4 5 N VAL A 33 ? N VAL A 33 O GLU A 63 ? O GLU A 63 A 5 6 N ALA A 58 ? N ALA A 58 O MET A 104 ? O MET A 104 # _atom_sites.entry_id 2MY9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 MET 99 99 99 MET MET A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 CYS 113 113 113 CYS CYS A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 SER 125 125 125 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-04-15 2 'Structure model' 1 1 2015-08-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id TIG3N-1 0.5 ? mM '[U-13C; U-15N]' 1 DSS-2 3 ? % ? 1 DTT-3 20 ? mM ? 1 'sodium chloride-4' 50 ? mM ? 1 'potassium chloride-5' 50 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MY9 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 6 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 3510 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 1360 _pdbx_nmr_constraints.NOE_long_range_total_count 532 _pdbx_nmr_constraints.NOE_medium_range_total_count 281 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 586 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 439 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 63 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 62 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 6 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 41 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 52 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.54 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 111 ? ? CZ A ARG 111 ? ? NH2 A ARG 111 ? ? 116.91 120.30 -3.39 0.50 N 2 2 NE A ARG 75 ? ? CZ A ARG 75 ? ? NH2 A ARG 75 ? ? 117.07 120.30 -3.23 0.50 N 3 3 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH1 A ARG 121 ? ? 123.30 120.30 3.00 0.50 N 4 4 NE A ARG 75 ? ? CZ A ARG 75 ? ? NH2 A ARG 75 ? ? 117.23 120.30 -3.07 0.50 N 5 4 NE A ARG 111 ? ? CZ A ARG 111 ? ? NH1 A ARG 111 ? ? 123.89 120.30 3.59 0.50 N 6 5 NE A ARG 111 ? ? CZ A ARG 111 ? ? NH1 A ARG 111 ? ? 123.40 120.30 3.10 0.50 N 7 5 NE A ARG 111 ? ? CZ A ARG 111 ? ? NH2 A ARG 111 ? ? 116.16 120.30 -4.14 0.50 N 8 6 NE A ARG 111 ? ? CZ A ARG 111 ? ? NH2 A ARG 111 ? ? 116.96 120.30 -3.34 0.50 N 9 7 NE A ARG 111 ? ? CZ A ARG 111 ? ? NH1 A ARG 111 ? ? 123.39 120.30 3.09 0.50 N 10 7 NE A ARG 111 ? ? CZ A ARG 111 ? ? NH2 A ARG 111 ? ? 116.90 120.30 -3.40 0.50 N 11 7 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH1 A ARG 121 ? ? 123.60 120.30 3.30 0.50 N 12 10 NE A ARG 87 ? ? CZ A ARG 87 ? ? NH1 A ARG 87 ? ? 123.34 120.30 3.04 0.50 N 13 10 NE A ARG 111 ? ? CZ A ARG 111 ? ? NH1 A ARG 111 ? ? 123.48 120.30 3.18 0.50 N 14 10 NE A ARG 111 ? ? CZ A ARG 111 ? ? NH2 A ARG 111 ? ? 117.06 120.30 -3.24 0.50 N 15 10 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH1 A ARG 121 ? ? 123.31 120.30 3.01 0.50 N 16 12 NE A ARG 75 ? ? CZ A ARG 75 ? ? NH2 A ARG 75 ? ? 117.22 120.30 -3.08 0.50 N 17 13 NE A ARG 64 ? ? CZ A ARG 64 ? ? NH1 A ARG 64 ? ? 124.12 120.30 3.82 0.50 N 18 13 NE A ARG 75 ? ? CZ A ARG 75 ? ? NH2 A ARG 75 ? ? 117.29 120.30 -3.01 0.50 N 19 14 NE A ARG 111 ? ? CZ A ARG 111 ? ? NH1 A ARG 111 ? ? 123.79 120.30 3.49 0.50 N 20 14 NE A ARG 111 ? ? CZ A ARG 111 ? ? NH2 A ARG 111 ? ? 117.14 120.30 -3.16 0.50 N 21 16 NE A ARG 64 ? ? CZ A ARG 64 ? ? NH2 A ARG 64 ? ? 116.75 120.30 -3.55 0.50 N 22 18 NE A ARG 64 ? ? CZ A ARG 64 ? ? NH1 A ARG 64 ? ? 124.21 120.30 3.91 0.50 N 23 19 NE A ARG 64 ? ? CZ A ARG 64 ? ? NH1 A ARG 64 ? ? 124.08 120.30 3.78 0.50 N 24 19 NE A ARG 111 ? ? CZ A ARG 111 ? ? NH1 A ARG 111 ? ? 123.55 120.30 3.25 0.50 N 25 20 NE A ARG 75 ? ? CZ A ARG 75 ? ? NH2 A ARG 75 ? ? 117.28 120.30 -3.02 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 47 ? ? 76.78 -2.07 2 1 LYS A 105 ? ? -67.29 -174.46 3 1 TYR A 106 ? ? -68.06 -172.37 4 1 SER A 110 ? ? 57.32 -144.41 5 1 ASN A 112 ? ? -142.57 -17.50 6 2 PHE A 17 ? ? -90.55 59.83 7 2 VAL A 50 ? ? 73.09 -46.58 8 2 ASN A 77 ? ? -150.88 80.55 9 2 ILE A 108 ? ? 58.10 -31.45 10 3 TYR A 42 ? ? 86.71 -9.82 11 3 ASN A 56 ? ? 78.77 157.00 12 3 SER A 107 ? ? 71.01 -31.12 13 4 LEU A 54 ? ? 66.44 -166.13 14 4 ASN A 77 ? ? -163.06 93.52 15 4 ILE A 108 ? ? 57.63 -31.81 16 5 ASN A 56 ? ? -128.36 -77.42 17 6 GLU A 41 ? ? -160.57 92.37 18 6 SER A 47 ? ? -158.44 -111.88 19 6 SER A 55 ? ? -131.99 -35.81 20 6 ARG A 111 ? ? 82.07 133.52 21 6 ASN A 112 ? ? -177.57 -58.80 22 7 TYR A 21 ? ? -170.51 142.89 23 7 SER A 40 ? ? 70.80 -22.20 24 7 VAL A 50 ? ? 59.13 18.21 25 7 SER A 52 ? ? 70.07 -26.55 26 7 SER A 55 ? ? -135.48 -49.45 27 7 ASN A 77 ? ? -154.94 85.41 28 7 ASN A 78 ? ? -79.11 46.99 29 7 ILE A 108 ? ? -68.37 21.42 30 8 GLU A 41 ? ? 74.26 -58.95 31 8 SER A 47 ? ? -80.00 -156.44 32 8 LEU A 54 ? ? 65.14 -25.45 33 8 ARG A 111 ? ? 66.64 86.14 34 9 HIS A 5 ? ? 80.13 160.69 35 9 SER A 40 ? ? 72.07 -18.99 36 9 SER A 52 ? ? -75.12 42.70 37 9 LYS A 124 ? ? 43.60 -144.85 38 10 SER A 48 ? ? -90.79 -98.15 39 10 SER A 49 ? ? 65.90 -51.33 40 10 ASN A 56 ? ? -75.11 41.05 41 10 ASN A 77 ? ? -152.65 84.77 42 10 ILE A 108 ? ? -167.06 97.42 43 10 VAL A 109 ? ? 69.73 -61.85 44 11 CYS A 72 ? ? -126.31 -160.86 45 11 SER A 107 ? ? -76.79 36.28 46 11 ILE A 108 ? ? 55.54 -14.21 47 11 ARG A 111 ? ? 117.05 -20.59 48 11 ASN A 112 ? ? -59.14 -6.96 49 12 SER A 49 ? ? -98.29 -147.20 50 12 ASN A 77 ? ? -152.71 85.24 51 12 ILE A 108 ? ? -73.72 33.52 52 13 GLU A 41 ? ? 66.84 -156.20 53 13 SER A 49 ? ? 70.96 -170.67 54 13 VAL A 53 ? ? -160.74 109.98 55 13 VAL A 109 ? ? 78.55 -36.17 56 14 LEU A 19 ? ? -58.75 107.87 57 14 SER A 48 ? ? -74.48 45.94 58 14 SER A 49 ? ? -64.71 26.94 59 14 LEU A 54 ? ? -114.37 -154.19 60 14 ASN A 56 ? ? -148.84 22.96 61 14 ASN A 77 ? ? -155.87 87.30 62 14 VAL A 109 ? ? 132.63 -37.65 63 15 ASN A 77 ? ? -153.77 80.47 64 16 VAL A 53 ? ? -103.02 68.54 65 16 SER A 55 ? ? -57.84 109.56 66 16 ASN A 56 ? ? -140.77 32.06 67 16 VAL A 109 ? ? -131.23 -45.29 68 16 ASN A 112 ? ? -144.45 -12.18 69 16 LYS A 124 ? ? 38.01 -145.60 70 17 LEU A 19 ? ? -55.94 108.93 71 17 TYR A 42 ? ? 88.00 129.28 72 17 VAL A 53 ? ? 63.91 72.91 73 18 SER A 47 ? ? -165.00 -165.91 74 18 LEU A 54 ? ? -104.61 -78.17 75 18 ASN A 77 ? ? -153.86 84.86 76 18 ASN A 112 ? ? -165.69 -64.75 77 19 ALA A 45 ? ? -167.28 -165.85 78 19 SER A 55 ? ? 72.48 169.80 79 19 ASN A 56 ? ? 179.48 158.17 80 19 SER A 107 ? ? -68.56 41.03 81 19 VAL A 109 ? ? 72.73 -44.81 82 20 SER A 49 ? ? -79.77 49.74 83 20 VAL A 50 ? ? -80.14 46.08 84 20 LEU A 54 ? ? -69.50 -72.84 85 20 SER A 55 ? ? 66.17 -34.27 86 20 VAL A 109 ? ? 71.75 -49.44 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 13 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 87 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.084 _pdbx_validate_planes.type 'SIDE CHAIN' #