data_2MZG # _entry.id 2MZG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104229 RCSB ? ? 2MZG PDB pdb_00002mzg 10.2210/pdb2mzg/pdb 25487 BMRB ? 10.13018/BMR25487 D_1000104229 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-04-13 2 'Structure model' 1 1 2019-04-17 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_nmr_software 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_database_status 6 3 'Structure model' pdbx_nmr_spectrometer 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' database_2 10 4 'Structure model' pdbx_entry_details 11 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_pdbx_nmr_software.name' 14 3 'Structure model' '_database_2.pdbx_DOI' 15 3 'Structure model' '_database_2.pdbx_database_accession' 16 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 17 3 'Structure model' '_pdbx_nmr_spectrometer.model' 18 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MZG _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-02-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 25486 BMRB . unspecified 2mzf PDB . unspecified 25487 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nadezhdin, K.' 1 'Oparin, P.' 2 'Vassilevski, A.' 3 'Grishin, E.' 4 'Arseniev, A.' 5 # _citation.id primary _citation.title 'Structure of purotoxin-2 from wolf spider: modular design and membrane-assisted mode of action in arachnid toxins.' _citation.journal_abbrev 'Biochem. J.' _citation.journal_volume 473 _citation.page_first 3113 _citation.page_last 3126 _citation.year 2016 _citation.journal_id_ASTM BIJOAK _citation.country UK _citation.journal_id_ISSN 1470-8728 _citation.journal_id_CSD 0043 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27412961 _citation.pdbx_database_id_DOI 10.1042/BCJ20160573 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Oparin, P.B.' 1 ? primary 'Nadezhdin, K.D.' 2 ? primary 'Berkut, A.A.' 3 ? primary 'Arseniev, A.S.' 4 ? primary 'Grishin, E.V.' 5 ? primary 'Vassilevski, A.A.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Purotoxin-2 _entity.formula_weight 7278.393 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name PT2 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AKACTPLLHDCSHDRHSCCRGDMFKYVCDCFYPEGEDKTEVCSCQQPKSHKIAEKIIDKAKTTL _entity_poly.pdbx_seq_one_letter_code_can AKACTPLLHDCSHDRHSCCRGDMFKYVCDCFYPEGEDKTEVCSCQQPKSHKIAEKIIDKAKTTL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LYS n 1 3 ALA n 1 4 CYS n 1 5 THR n 1 6 PRO n 1 7 LEU n 1 8 LEU n 1 9 HIS n 1 10 ASP n 1 11 CYS n 1 12 SER n 1 13 HIS n 1 14 ASP n 1 15 ARG n 1 16 HIS n 1 17 SER n 1 18 CYS n 1 19 CYS n 1 20 ARG n 1 21 GLY n 1 22 ASP n 1 23 MET n 1 24 PHE n 1 25 LYS n 1 26 TYR n 1 27 VAL n 1 28 CYS n 1 29 ASP n 1 30 CYS n 1 31 PHE n 1 32 TYR n 1 33 PRO n 1 34 GLU n 1 35 GLY n 1 36 GLU n 1 37 ASP n 1 38 LYS n 1 39 THR n 1 40 GLU n 1 41 VAL n 1 42 CYS n 1 43 SER n 1 44 CYS n 1 45 GLN n 1 46 GLN n 1 47 PRO n 1 48 LYS n 1 49 SER n 1 50 HIS n 1 51 LYS n 1 52 ILE n 1 53 ALA n 1 54 GLU n 1 55 LYS n 1 56 ILE n 1 57 ILE n 1 58 ASP n 1 59 LYS n 1 60 ALA n 1 61 LYS n 1 62 THR n 1 63 THR n 1 64 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Wolf spider' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Geolycosa sp. A267TDLS2-KZARNA' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 420151 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET32b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LEU 64 64 64 LEU LEU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MZG _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MZG _struct.title 'Purotoxin-2 NMR structure in DPC micelles' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MZG _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'purotoxin-2, spider venom, module toxin, DPC micelles, toxin' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TXPR2_GEOA2 _struct_ref.pdbx_db_accession B3EWH0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AKACTPLLHDCSHDRHSCCRGDMFKYVCDCFYPEGEDKTEVCSCQQPKSHKIAEKIIDKAKTTL _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MZG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B3EWH0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 64 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 64 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 47 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 64 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 47 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 64 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 19 SG ? ? A CYS 4 A CYS 19 1_555 ? ? ? ? ? ? ? 1.874 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 11 A CYS 28 1_555 ? ? ? ? ? ? ? 1.987 ? ? disulf3 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 18 A CYS 44 1_555 ? ? ? ? ? ? ? 1.984 ? ? disulf4 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 30 A CYS 42 1_555 ? ? ? ? ? ? ? 2.003 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 19 ? CYS A 4 ? 1_555 CYS A 19 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 11 ? CYS A 28 ? CYS A 11 ? 1_555 CYS A 28 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 18 ? CYS A 44 ? CYS A 18 ? 1_555 CYS A 44 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 30 ? CYS A 42 ? CYS A 30 ? 1_555 CYS A 42 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 27 ? PHE A 31 ? VAL A 27 PHE A 31 A 2 VAL A 41 ? GLN A 45 ? VAL A 41 GLN A 45 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 27 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 45 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 45 # _pdbx_entry_details.entry_id 2MZG _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 6 ? ? -69.74 -168.61 2 1 ASP A 14 ? ? -162.77 119.01 3 1 PRO A 33 ? ? -69.68 76.81 4 1 THR A 39 ? ? -160.31 107.19 5 2 PRO A 6 ? ? -69.72 -168.84 6 2 ASP A 14 ? ? -167.60 115.31 7 2 MET A 23 ? ? -100.18 -67.98 8 2 PRO A 33 ? ? -69.70 73.95 9 2 LYS A 38 ? ? -110.18 -75.08 10 3 PRO A 6 ? ? -69.75 -172.88 11 3 PRO A 33 ? ? -69.76 74.05 12 3 LYS A 38 ? ? -124.01 -74.80 13 4 PRO A 6 ? ? -69.83 -171.97 14 4 ASP A 14 ? ? -161.54 115.99 15 4 CYS A 19 ? ? -52.93 171.99 16 4 PRO A 33 ? ? -69.69 75.90 17 5 ALA A 3 ? ? -88.12 31.15 18 5 THR A 5 ? ? -113.14 78.87 19 5 PRO A 6 ? ? -69.73 -169.04 20 5 ARG A 20 ? ? -59.35 171.40 21 5 PRO A 33 ? ? -69.78 74.00 22 5 LYS A 38 ? ? -112.28 -73.50 23 6 PRO A 6 ? ? -69.79 -168.84 24 6 PRO A 33 ? ? -69.78 74.54 25 6 LYS A 38 ? ? -128.20 -75.11 26 7 PRO A 6 ? ? -69.87 -172.06 27 7 ARG A 15 ? ? -76.25 -74.51 28 7 PRO A 33 ? ? -69.78 74.33 29 7 LYS A 38 ? ? -123.54 -74.76 30 8 PRO A 6 ? ? -69.83 -170.56 31 8 TYR A 32 ? ? -115.13 77.52 32 8 PRO A 33 ? ? -69.76 76.59 33 8 LYS A 38 ? ? -122.66 -52.47 34 9 PRO A 6 ? ? -69.80 -169.85 35 9 ARG A 15 ? ? -75.76 -74.94 36 9 PRO A 33 ? ? -69.73 77.67 37 9 THR A 39 ? ? -160.41 102.62 38 10 ALA A 3 ? ? -88.14 32.98 39 10 PRO A 6 ? ? -69.70 -172.71 40 10 ARG A 15 ? ? -74.07 -74.12 41 10 PRO A 33 ? ? -69.77 74.44 42 10 LYS A 38 ? ? -104.15 -75.03 43 11 PRO A 6 ? ? -69.71 -172.61 44 11 CYS A 19 ? ? -52.71 171.89 45 11 PRO A 33 ? ? -69.77 77.30 46 11 LYS A 38 ? ? -139.85 -49.62 47 11 THR A 39 ? ? -161.91 115.80 48 12 PRO A 6 ? ? -69.84 -167.39 49 12 PRO A 33 ? ? -69.69 74.47 50 12 ASP A 37 ? ? -94.70 38.68 51 12 LYS A 38 ? ? -132.96 -74.92 52 13 PRO A 6 ? ? -69.83 -168.43 53 13 ASP A 14 ? ? -170.39 113.97 54 13 MET A 23 ? ? -99.91 -63.70 55 13 PRO A 33 ? ? -69.74 73.99 56 13 LYS A 38 ? ? -114.57 -74.62 57 14 ALA A 3 ? ? -87.27 42.00 58 14 PRO A 6 ? ? -69.74 -171.47 59 14 PRO A 33 ? ? -69.75 74.97 60 14 LYS A 38 ? ? -139.55 -62.10 61 15 PRO A 6 ? ? -69.82 -168.34 62 15 ASP A 14 ? ? -165.87 116.00 63 15 MET A 23 ? ? -105.18 -61.36 64 15 PRO A 33 ? ? -69.75 75.08 65 15 LYS A 38 ? ? -127.79 -75.17 66 16 PRO A 6 ? ? -69.81 -166.76 67 16 ASP A 14 ? ? -162.75 114.46 68 16 PRO A 33 ? ? -69.72 71.13 69 16 ASP A 37 ? ? -68.71 -72.09 70 17 PRO A 6 ? ? -69.74 -169.97 71 17 GLU A 34 ? ? 76.06 34.00 72 17 GLU A 36 ? ? -101.80 79.18 73 18 ALA A 3 ? ? -86.43 47.34 74 18 PRO A 6 ? ? -69.75 -170.79 75 18 ARG A 15 ? ? -76.29 -70.46 76 18 PRO A 33 ? ? -69.83 74.40 77 18 LYS A 38 ? ? -138.51 -75.05 78 19 PRO A 6 ? ? -69.80 -168.84 79 19 TYR A 32 ? ? -118.35 77.44 80 19 PRO A 33 ? ? -69.69 76.42 81 20 THR A 5 ? ? -114.73 79.55 82 20 PRO A 6 ? ? -69.76 -170.60 83 20 GLU A 34 ? ? 75.69 31.53 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MZG _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MZG _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.contents '1 mM [U-100% 15N] protein, 100 mM DPC, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 1 ? mM '[U-100% 15N]' 1 DPC-2 100 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 3.3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNHA' 1 4 1 '3D HNHB' 1 5 1 '3D 1H-15N NOESY' # _pdbx_nmr_refine.entry_id 2MZG _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Bruker Biospin' 'data analysis' TopSpin ? 2 'Bruker Biospin' processing TopSpin ? 3 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 4 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 5 'Keller and Wuthrich' 'data analysis' CARA ? 6 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 7 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TYR N N N N 301 TYR CA C N S 302 TYR C C N N 303 TYR O O N N 304 TYR CB C N N 305 TYR CG C Y N 306 TYR CD1 C Y N 307 TYR CD2 C Y N 308 TYR CE1 C Y N 309 TYR CE2 C Y N 310 TYR CZ C Y N 311 TYR OH O N N 312 TYR OXT O N N 313 TYR H H N N 314 TYR H2 H N N 315 TYR HA H N N 316 TYR HB2 H N N 317 TYR HB3 H N N 318 TYR HD1 H N N 319 TYR HD2 H N N 320 TYR HE1 H N N 321 TYR HE2 H N N 322 TYR HH H N N 323 TYR HXT H N N 324 VAL N N N N 325 VAL CA C N S 326 VAL C C N N 327 VAL O O N N 328 VAL CB C N N 329 VAL CG1 C N N 330 VAL CG2 C N N 331 VAL OXT O N N 332 VAL H H N N 333 VAL H2 H N N 334 VAL HA H N N 335 VAL HB H N N 336 VAL HG11 H N N 337 VAL HG12 H N N 338 VAL HG13 H N N 339 VAL HG21 H N N 340 VAL HG22 H N N 341 VAL HG23 H N N 342 VAL HXT H N N 343 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 MET N CA sing N N 200 MET N H sing N N 201 MET N H2 sing N N 202 MET CA C sing N N 203 MET CA CB sing N N 204 MET CA HA sing N N 205 MET C O doub N N 206 MET C OXT sing N N 207 MET CB CG sing N N 208 MET CB HB2 sing N N 209 MET CB HB3 sing N N 210 MET CG SD sing N N 211 MET CG HG2 sing N N 212 MET CG HG3 sing N N 213 MET SD CE sing N N 214 MET CE HE1 sing N N 215 MET CE HE2 sing N N 216 MET CE HE3 sing N N 217 MET OXT HXT sing N N 218 PHE N CA sing N N 219 PHE N H sing N N 220 PHE N H2 sing N N 221 PHE CA C sing N N 222 PHE CA CB sing N N 223 PHE CA HA sing N N 224 PHE C O doub N N 225 PHE C OXT sing N N 226 PHE CB CG sing N N 227 PHE CB HB2 sing N N 228 PHE CB HB3 sing N N 229 PHE CG CD1 doub Y N 230 PHE CG CD2 sing Y N 231 PHE CD1 CE1 sing Y N 232 PHE CD1 HD1 sing N N 233 PHE CD2 CE2 doub Y N 234 PHE CD2 HD2 sing N N 235 PHE CE1 CZ doub Y N 236 PHE CE1 HE1 sing N N 237 PHE CE2 CZ sing Y N 238 PHE CE2 HE2 sing N N 239 PHE CZ HZ sing N N 240 PHE OXT HXT sing N N 241 PRO N CA sing N N 242 PRO N CD sing N N 243 PRO N H sing N N 244 PRO CA C sing N N 245 PRO CA CB sing N N 246 PRO CA HA sing N N 247 PRO C O doub N N 248 PRO C OXT sing N N 249 PRO CB CG sing N N 250 PRO CB HB2 sing N N 251 PRO CB HB3 sing N N 252 PRO CG CD sing N N 253 PRO CG HG2 sing N N 254 PRO CG HG3 sing N N 255 PRO CD HD2 sing N N 256 PRO CD HD3 sing N N 257 PRO OXT HXT sing N N 258 SER N CA sing N N 259 SER N H sing N N 260 SER N H2 sing N N 261 SER CA C sing N N 262 SER CA CB sing N N 263 SER CA HA sing N N 264 SER C O doub N N 265 SER C OXT sing N N 266 SER CB OG sing N N 267 SER CB HB2 sing N N 268 SER CB HB3 sing N N 269 SER OG HG sing N N 270 SER OXT HXT sing N N 271 THR N CA sing N N 272 THR N H sing N N 273 THR N H2 sing N N 274 THR CA C sing N N 275 THR CA CB sing N N 276 THR CA HA sing N N 277 THR C O doub N N 278 THR C OXT sing N N 279 THR CB OG1 sing N N 280 THR CB CG2 sing N N 281 THR CB HB sing N N 282 THR OG1 HG1 sing N N 283 THR CG2 HG21 sing N N 284 THR CG2 HG22 sing N N 285 THR CG2 HG23 sing N N 286 THR OXT HXT sing N N 287 TYR N CA sing N N 288 TYR N H sing N N 289 TYR N H2 sing N N 290 TYR CA C sing N N 291 TYR CA CB sing N N 292 TYR CA HA sing N N 293 TYR C O doub N N 294 TYR C OXT sing N N 295 TYR CB CG sing N N 296 TYR CB HB2 sing N N 297 TYR CB HB3 sing N N 298 TYR CG CD1 doub Y N 299 TYR CG CD2 sing Y N 300 TYR CD1 CE1 sing Y N 301 TYR CD1 HD1 sing N N 302 TYR CD2 CE2 doub Y N 303 TYR CD2 HD2 sing N N 304 TYR CE1 CZ doub Y N 305 TYR CE1 HE1 sing N N 306 TYR CE2 CZ sing Y N 307 TYR CE2 HE2 sing N N 308 TYR CZ OH sing N N 309 TYR OH HH sing N N 310 TYR OXT HXT sing N N 311 VAL N CA sing N N 312 VAL N H sing N N 313 VAL N H2 sing N N 314 VAL CA C sing N N 315 VAL CA CB sing N N 316 VAL CA HA sing N N 317 VAL C O doub N N 318 VAL C OXT sing N N 319 VAL CB CG1 sing N N 320 VAL CB CG2 sing N N 321 VAL CB HB sing N N 322 VAL CG1 HG11 sing N N 323 VAL CG1 HG12 sing N N 324 VAL CG1 HG13 sing N N 325 VAL CG2 HG21 sing N N 326 VAL CG2 HG22 sing N N 327 VAL CG2 HG23 sing N N 328 VAL OXT HXT sing N N 329 # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2MZG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #