data_2MZS # _entry.id 2MZS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104241 RCSB ? ? 2MZS PDB pdb_00002mzs 10.2210/pdb2mzs/pdb 25498 BMRB ? 10.13018/BMR25498 D_1000104241 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-02 2 'Structure model' 1 1 2015-12-09 3 'Structure model' 1 2 2016-01-27 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_struct_ref_seq_dif.details' 7 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MZS _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-02-23 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25498 BMRB unspecified . 2MZQ PDB unspecified . 2MZR PDB unspecified . 2MZT PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Martinez-Lumbreras, S.' 1 'Seraphin, B.' 2 'Perez-Canadillas, J.' 3 # _citation.id primary _citation.title 'Gbp2 interacts with THO/TREX through a novel type of RRM domain.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 44 _citation.page_first 437 _citation.page_last 448 _citation.year 2016 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26602689 _citation.pdbx_database_id_DOI 10.1093/nar/gkv1303 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Martinez-Lumbreras, S.' 1 ? primary 'Taverniti, V.' 2 ? primary 'Zorrilla, S.' 3 ? primary 'Seraphin, B.' 4 ? primary 'Perez-Canadillas, J.M.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein HRB1' _entity.formula_weight 10701.634 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Second RRM domain (UNP residues 262-358)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein TOM34' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSEVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDVKSKESV HNHSDGDDVDIPMDDSPVN ; _entity_poly.pdbx_seq_one_letter_code_can ;GSEVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDVKSKESV HNHSDGDDVDIPMDDSPVN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLU n 1 4 VAL n 1 5 ILE n 1 6 VAL n 1 7 LYS n 1 8 ASN n 1 9 LEU n 1 10 PRO n 1 11 ALA n 1 12 SER n 1 13 VAL n 1 14 ASN n 1 15 TRP n 1 16 GLN n 1 17 ALA n 1 18 LEU n 1 19 LYS n 1 20 ASP n 1 21 ILE n 1 22 PHE n 1 23 LYS n 1 24 GLU n 1 25 CYS n 1 26 GLY n 1 27 ASN n 1 28 VAL n 1 29 ALA n 1 30 HIS n 1 31 ALA n 1 32 ASP n 1 33 VAL n 1 34 GLU n 1 35 LEU n 1 36 ASP n 1 37 GLY n 1 38 ASP n 1 39 GLY n 1 40 VAL n 1 41 SER n 1 42 THR n 1 43 GLY n 1 44 SER n 1 45 GLY n 1 46 THR n 1 47 VAL n 1 48 SER n 1 49 PHE n 1 50 TYR n 1 51 ASP n 1 52 ILE n 1 53 LYS n 1 54 ASP n 1 55 LEU n 1 56 HIS n 1 57 ARG n 1 58 ALA n 1 59 ILE n 1 60 GLU n 1 61 LYS n 1 62 TYR n 1 63 ASN n 1 64 GLY n 1 65 TYR n 1 66 SER n 1 67 ILE n 1 68 GLU n 1 69 GLY n 1 70 ASN n 1 71 VAL n 1 72 LEU n 1 73 ASP n 1 74 VAL n 1 75 LYS n 1 76 SER n 1 77 LYS n 1 78 GLU n 1 79 SER n 1 80 VAL n 1 81 HIS n 1 82 ASN n 1 83 HIS n 1 84 SER n 1 85 ASP n 1 86 GLY n 1 87 ASP n 1 88 ASP n 1 89 VAL n 1 90 ASP n 1 91 ILE n 1 92 PRO n 1 93 MET n 1 94 ASP n 1 95 ASP n 1 96 SER n 1 97 PRO n 1 98 VAL n 1 99 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HRB1, N2009, TOM34, YNL004W' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 260 260 GLY GLY A . n A 1 2 SER 2 261 261 SER SER A . n A 1 3 GLU 3 262 262 GLU GLU A . n A 1 4 VAL 4 263 263 VAL VAL A . n A 1 5 ILE 5 264 264 ILE ILE A . n A 1 6 VAL 6 265 265 VAL VAL A . n A 1 7 LYS 7 266 266 LYS LYS A . n A 1 8 ASN 8 267 267 ASN ASN A . n A 1 9 LEU 9 268 268 LEU LEU A . n A 1 10 PRO 10 269 269 PRO PRO A . n A 1 11 ALA 11 270 270 ALA ALA A . n A 1 12 SER 12 271 271 SER SER A . n A 1 13 VAL 13 272 272 VAL VAL A . n A 1 14 ASN 14 273 273 ASN ASN A . n A 1 15 TRP 15 274 274 TRP TRP A . n A 1 16 GLN 16 275 275 GLN GLN A . n A 1 17 ALA 17 276 276 ALA ALA A . n A 1 18 LEU 18 277 277 LEU LEU A . n A 1 19 LYS 19 278 278 LYS LYS A . n A 1 20 ASP 20 279 279 ASP ASP A . n A 1 21 ILE 21 280 280 ILE ILE A . n A 1 22 PHE 22 281 281 PHE PHE A . n A 1 23 LYS 23 282 282 LYS LYS A . n A 1 24 GLU 24 283 283 GLU GLU A . n A 1 25 CYS 25 284 284 CYS CYS A . n A 1 26 GLY 26 285 285 GLY GLY A . n A 1 27 ASN 27 286 286 ASN ASN A . n A 1 28 VAL 28 287 287 VAL VAL A . n A 1 29 ALA 29 288 288 ALA ALA A . n A 1 30 HIS 30 289 289 HIS HIS A . n A 1 31 ALA 31 290 290 ALA ALA A . n A 1 32 ASP 32 291 291 ASP ASP A . n A 1 33 VAL 33 292 292 VAL VAL A . n A 1 34 GLU 34 293 293 GLU GLU A . n A 1 35 LEU 35 294 294 LEU LEU A . n A 1 36 ASP 36 295 295 ASP ASP A . n A 1 37 GLY 37 296 296 GLY GLY A . n A 1 38 ASP 38 297 297 ASP ASP A . n A 1 39 GLY 39 298 298 GLY GLY A . n A 1 40 VAL 40 299 299 VAL VAL A . n A 1 41 SER 41 300 300 SER SER A . n A 1 42 THR 42 301 301 THR THR A . n A 1 43 GLY 43 302 302 GLY GLY A . n A 1 44 SER 44 303 303 SER SER A . n A 1 45 GLY 45 304 304 GLY GLY A . n A 1 46 THR 46 305 305 THR THR A . n A 1 47 VAL 47 306 306 VAL VAL A . n A 1 48 SER 48 307 307 SER SER A . n A 1 49 PHE 49 308 308 PHE PHE A . n A 1 50 TYR 50 309 309 TYR TYR A . n A 1 51 ASP 51 310 310 ASP ASP A . n A 1 52 ILE 52 311 311 ILE ILE A . n A 1 53 LYS 53 312 312 LYS LYS A . n A 1 54 ASP 54 313 313 ASP ASP A . n A 1 55 LEU 55 314 314 LEU LEU A . n A 1 56 HIS 56 315 315 HIS HIS A . n A 1 57 ARG 57 316 316 ARG ARG A . n A 1 58 ALA 58 317 317 ALA ALA A . n A 1 59 ILE 59 318 318 ILE ILE A . n A 1 60 GLU 60 319 319 GLU GLU A . n A 1 61 LYS 61 320 320 LYS LYS A . n A 1 62 TYR 62 321 321 TYR TYR A . n A 1 63 ASN 63 322 322 ASN ASN A . n A 1 64 GLY 64 323 323 GLY GLY A . n A 1 65 TYR 65 324 324 TYR TYR A . n A 1 66 SER 66 325 325 SER SER A . n A 1 67 ILE 67 326 326 ILE ILE A . n A 1 68 GLU 68 327 327 GLU GLU A . n A 1 69 GLY 69 328 328 GLY GLY A . n A 1 70 ASN 70 329 329 ASN ASN A . n A 1 71 VAL 71 330 330 VAL VAL A . n A 1 72 LEU 72 331 331 LEU LEU A . n A 1 73 ASP 73 332 332 ASP ASP A . n A 1 74 VAL 74 333 333 VAL VAL A . n A 1 75 LYS 75 334 334 LYS LYS A . n A 1 76 SER 76 335 335 SER SER A . n A 1 77 LYS 77 336 336 LYS LYS A . n A 1 78 GLU 78 337 337 GLU GLU A . n A 1 79 SER 79 338 338 SER SER A . n A 1 80 VAL 80 339 339 VAL VAL A . n A 1 81 HIS 81 340 340 HIS HIS A . n A 1 82 ASN 82 341 341 ASN ASN A . n A 1 83 HIS 83 342 342 HIS HIS A . n A 1 84 SER 84 343 343 SER SER A . n A 1 85 ASP 85 344 344 ASP ASP A . n A 1 86 GLY 86 345 345 GLY GLY A . n A 1 87 ASP 87 346 346 ASP ASP A . n A 1 88 ASP 88 347 347 ASP ASP A . n A 1 89 VAL 89 348 348 VAL VAL A . n A 1 90 ASP 90 349 349 ASP ASP A . n A 1 91 ILE 91 350 350 ILE ILE A . n A 1 92 PRO 92 351 351 PRO PRO A . n A 1 93 MET 93 352 352 MET MET A . n A 1 94 ASP 94 353 353 ASP ASP A . n A 1 95 ASP 95 354 354 ASP ASP A . n A 1 96 SER 96 355 355 SER SER A . n A 1 97 PRO 97 356 356 PRO PRO A . n A 1 98 VAL 98 357 357 VAL VAL A . n A 1 99 ASN 99 358 358 ASN ASN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MZS _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MZS _struct.title 'NMR structure of the RRM2 domain of Hrb1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MZS _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'RRM, RNA binding domain, Hrb1, THO/TREX, RNA binding protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HRB1_YEAST _struct_ref.pdbx_db_accession P38922 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDVKSKESVHN HSDGDDVDIPMDDSPVN ; _struct_ref.pdbx_align_begin 262 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MZS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P38922 _struct_ref_seq.db_align_beg 262 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 358 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 262 _struct_ref_seq.pdbx_auth_seq_align_end 358 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MZS GLY A 1 ? UNP P38922 ? ? 'expression tag' 260 1 1 2MZS SER A 2 ? UNP P38922 ? ? 'expression tag' 261 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 14 ? GLU A 24 ? ASN A 273 GLU A 283 1 ? 11 HELX_P HELX_P2 2 ASP A 51 ? ASN A 63 ? ASP A 310 ASN A 322 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 30 ? ASP A 32 ? HIS A 289 ASP A 291 A 2 GLY A 45 ? SER A 48 ? GLY A 304 SER A 307 A 3 VAL A 4 ? VAL A 6 ? VAL A 263 VAL A 265 A 4 VAL A 74 ? SER A 76 ? VAL A 333 SER A 335 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 32 ? N ASP A 291 O THR A 46 ? O THR A 305 A 2 3 O VAL A 47 ? O VAL A 306 N VAL A 4 ? N VAL A 263 A 3 4 N ILE A 5 ? N ILE A 264 O LYS A 75 ? O LYS A 334 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 262 ? ? 67.99 168.34 2 1 LYS A 266 ? ? -140.15 35.59 3 1 ASN A 267 ? ? -160.58 -22.43 4 1 ALA A 288 ? ? -109.31 -114.50 5 1 SER A 300 ? ? 66.76 -177.11 6 1 THR A 301 ? ? -142.87 -35.46 7 1 GLU A 337 ? ? 61.68 -144.89 8 1 HIS A 340 ? ? -160.09 2.32 9 1 HIS A 342 ? ? 61.86 -179.25 10 1 SER A 343 ? ? -163.23 114.53 11 1 ASP A 349 ? ? -142.65 45.88 12 2 SER A 261 ? ? 76.38 154.73 13 2 GLU A 262 ? ? 68.68 170.92 14 2 LYS A 266 ? ? -145.61 24.99 15 2 ASN A 267 ? ? -161.55 -22.54 16 2 VAL A 272 ? ? -113.60 60.58 17 2 ALA A 288 ? ? -91.80 -125.39 18 2 SER A 300 ? ? 75.98 171.68 19 2 VAL A 339 ? ? -170.82 144.88 20 2 SER A 343 ? ? -171.43 143.57 21 2 VAL A 348 ? ? -170.27 135.42 22 2 ASP A 349 ? ? -156.44 39.64 23 3 ASN A 267 ? ? -174.36 -42.21 24 3 LEU A 268 ? ? -34.75 116.97 25 3 VAL A 272 ? ? -108.28 79.88 26 3 LYS A 282 ? ? -64.93 0.15 27 3 ALA A 288 ? ? -79.44 -104.75 28 3 THR A 301 ? ? -146.09 -27.24 29 3 SER A 338 ? ? -167.41 -169.86 30 3 SER A 343 ? ? 77.89 155.80 31 3 ASP A 349 ? ? -166.75 115.10 32 4 ASN A 267 ? ? -168.21 -25.64 33 4 ALA A 270 ? ? -59.98 -5.78 34 4 ALA A 288 ? ? -89.35 -96.01 35 4 SER A 300 ? ? 73.54 163.65 36 4 GLU A 327 ? ? 59.49 18.96 37 4 ASP A 353 ? ? -159.51 8.31 38 4 ASP A 354 ? ? -85.92 31.72 39 4 VAL A 357 ? ? 74.49 115.20 40 5 SER A 261 ? ? -143.26 17.98 41 5 LYS A 266 ? ? -150.01 78.37 42 5 ASN A 267 ? ? -176.71 -34.83 43 5 ALA A 270 ? ? -57.89 -7.42 44 5 ALA A 288 ? ? -101.01 -108.72 45 5 VAL A 357 ? ? -149.14 22.36 46 6 SER A 261 ? ? -153.29 33.45 47 6 ASN A 267 ? ? 83.91 -23.03 48 6 LEU A 268 ? ? -28.91 116.58 49 6 ALA A 288 ? ? -83.52 -128.84 50 6 GLU A 337 ? ? 59.10 -167.12 51 6 ASP A 349 ? ? -170.63 128.84 52 7 SER A 261 ? ? 66.22 -156.14 53 7 GLU A 262 ? ? 71.96 166.80 54 7 ASN A 267 ? ? -170.61 -44.67 55 7 ALA A 288 ? ? -73.43 -111.05 56 7 LEU A 294 ? ? -103.62 -157.06 57 7 VAL A 299 ? ? 58.94 10.46 58 7 THR A 301 ? ? -152.97 -54.81 59 7 VAL A 339 ? ? -168.91 -40.83 60 7 ASP A 349 ? ? -166.75 118.00 61 7 MET A 352 ? ? 73.38 146.08 62 7 ASP A 353 ? ? -163.30 -41.73 63 8 SER A 261 ? ? -157.25 33.60 64 8 LYS A 266 ? ? -150.50 50.46 65 8 ASN A 267 ? ? -160.94 -17.68 66 8 ALA A 288 ? ? -94.81 -121.04 67 8 SER A 300 ? ? 64.87 -179.39 68 8 GLU A 337 ? ? -161.05 -59.80 69 8 SER A 338 ? ? -163.77 -169.80 70 8 ASP A 354 ? ? -151.94 26.46 71 9 ASN A 267 ? ? -179.13 -32.21 72 9 ALA A 288 ? ? -85.36 -125.56 73 9 HIS A 342 ? ? 63.94 175.88 74 9 ASP A 349 ? ? -161.83 114.24 75 9 VAL A 357 ? ? 73.49 95.28 76 10 SER A 261 ? ? -176.60 98.04 77 10 ASN A 267 ? ? -168.51 -6.65 78 10 ALA A 288 ? ? -72.57 -79.40 79 10 HIS A 289 ? ? -178.45 147.01 80 10 SER A 338 ? ? 69.66 164.62 81 10 HIS A 340 ? ? -147.34 -13.67 82 10 ASP A 354 ? ? -150.21 18.27 83 11 LYS A 266 ? ? -140.15 42.50 84 11 ASN A 267 ? ? -158.34 -15.31 85 11 ALA A 288 ? ? -99.09 -111.76 86 11 SER A 300 ? ? 73.27 148.00 87 11 ASP A 310 ? ? -172.85 -170.62 88 11 VAL A 339 ? ? -170.99 147.48 89 12 ASN A 267 ? ? 96.97 -3.03 90 12 ALA A 288 ? ? -74.25 -72.69 91 12 SER A 300 ? ? 59.97 10.85 92 12 THR A 301 ? ? 50.47 10.07 93 12 SER A 338 ? ? -160.48 96.16 94 12 VAL A 339 ? ? -142.32 14.84 95 12 ASP A 349 ? ? -170.19 118.17 96 12 ASP A 354 ? ? -154.15 66.58 97 13 SER A 261 ? ? -148.95 26.00 98 13 ASN A 267 ? ? 82.35 -26.25 99 13 LEU A 268 ? ? -28.71 108.67 100 13 ALA A 288 ? ? -69.98 -79.61 101 13 SER A 300 ? ? -175.05 -174.13 102 13 THR A 301 ? ? -161.71 -51.71 103 13 ASP A 310 ? ? -172.16 -178.30 104 13 SER A 343 ? ? -167.29 -159.72 105 13 ASP A 349 ? ? -163.17 112.51 106 14 ASN A 267 ? ? -169.12 -40.48 107 14 ALA A 288 ? ? -77.53 -107.72 108 14 SER A 303 ? ? -36.70 126.94 109 14 GLU A 337 ? ? -138.37 -42.02 110 14 ASN A 341 ? ? 65.65 99.23 111 14 ASP A 346 ? ? 71.24 146.10 112 14 ASP A 349 ? ? 75.41 123.75 113 15 SER A 261 ? ? -162.13 13.88 114 15 LYS A 266 ? ? -149.71 55.33 115 15 ASN A 267 ? ? -167.58 -24.46 116 15 ALA A 270 ? ? -62.61 0.30 117 15 ALA A 288 ? ? -83.65 -106.42 118 15 THR A 301 ? ? 45.59 80.53 119 15 ASP A 349 ? ? -167.37 116.64 120 15 ASP A 354 ? ? -143.78 11.09 121 15 VAL A 357 ? ? 77.35 149.80 122 16 SER A 261 ? ? -152.35 21.63 123 16 LYS A 266 ? ? -146.17 58.50 124 16 ASN A 267 ? ? -164.36 -45.14 125 16 ALA A 288 ? ? -106.48 -120.03 126 16 ASP A 295 ? ? -48.25 153.72 127 16 SER A 300 ? ? 61.10 -168.08 128 16 THR A 301 ? ? -167.04 -45.47 129 16 ASP A 310 ? ? -172.65 -175.73 130 16 SER A 343 ? ? -157.15 32.78 131 16 ASP A 349 ? ? -161.84 113.91 132 16 MET A 352 ? ? -150.84 13.95 133 17 GLU A 262 ? ? 71.83 163.61 134 17 ASN A 267 ? ? -169.12 -41.68 135 17 LEU A 268 ? ? -28.17 110.92 136 17 CYS A 284 ? ? -69.02 0.32 137 17 ALA A 288 ? ? -76.95 -96.28 138 17 THR A 301 ? ? -144.15 -25.02 139 17 ASP A 310 ? ? -172.32 -176.34 140 17 GLU A 337 ? ? -157.30 -60.81 141 17 SER A 343 ? ? 75.84 158.62 142 17 ASP A 349 ? ? -164.14 114.73 143 18 LYS A 266 ? ? -148.69 59.64 144 18 ASN A 267 ? ? -171.42 -38.26 145 18 LEU A 268 ? ? -34.29 122.52 146 18 ALA A 288 ? ? -78.77 -94.73 147 18 ASP A 295 ? ? -47.96 151.97 148 18 VAL A 299 ? ? -90.19 58.74 149 18 SER A 300 ? ? 60.36 -163.48 150 18 SER A 343 ? ? -146.27 20.68 151 18 ASP A 346 ? ? -160.03 26.48 152 18 ASP A 349 ? ? -154.40 35.71 153 18 ASP A 354 ? ? -153.74 1.79 154 19 ASN A 267 ? ? -172.27 -38.82 155 19 LEU A 268 ? ? -34.82 123.26 156 19 ALA A 288 ? ? -95.06 -99.15 157 19 ASN A 341 ? ? -152.14 -144.14 158 20 SER A 261 ? ? 70.91 -55.98 159 20 GLU A 262 ? ? 63.09 176.65 160 20 LYS A 266 ? ? -142.95 46.47 161 20 ASN A 267 ? ? -168.99 -26.36 162 20 ALA A 288 ? ? -100.63 -114.00 163 20 ASP A 354 ? ? -152.34 30.54 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 2 VAL A 265 ? ? LYS A 266 ? ? -145.65 2 2 SER A 307 ? ? PHE A 308 ? ? -149.27 3 3 SER A 307 ? ? PHE A 308 ? ? -144.89 4 6 ASN A 267 ? ? LEU A 268 ? ? 144.56 5 8 VAL A 265 ? ? LYS A 266 ? ? -148.75 6 10 VAL A 265 ? ? LYS A 266 ? ? -148.69 7 11 TYR A 309 ? ? ASP A 310 ? ? 145.96 8 12 SER A 307 ? ? PHE A 308 ? ? -141.31 9 13 ASN A 267 ? ? LEU A 268 ? ? 145.28 10 20 VAL A 265 ? ? LYS A 266 ? ? -148.56 11 20 LEU A 331 ? ? ASP A 332 ? ? 148.69 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MZS _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MZS _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.2 mM protein, 25 mM potassium phosphate, 25 mM sodium chloride, 0.1 mM DTT, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.2 mM protein, 25 mM potassium phosphate, 25 mM sodium chloride, 0.1 mM DTT, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 0.2 ? mM ? 1 'potassium phosphate-2' 25 ? mM ? 1 'sodium chloride-3' 25 ? mM ? 1 DTT-4 0.1 ? mM ? 1 protein-5 0.2 ? mM ? 2 'potassium phosphate-6' 25 ? mM ? 2 'sodium chloride-7' 25 ? mM ? 2 DTT-8 0.1 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '2D 1H-1H TOCSY' 1 4 1 '2D 1H-1H NOESY' 1 5 1 '3D HNCO' 1 6 1 '3D HNCA' 1 7 1 '3D HNCACB' 1 8 2 '3D HCCH-TOCSY' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement Amber ? 2 'Bruker Biospin' collection TopSpin ? 3 CCPN 'chemical shift assignment' 'CcpNmr Analysis' ? 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2MZS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_