data_2N04 # _entry.id 2N04 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104253 RCSB ? ? 2N04 PDB pdb_00002n04 10.2210/pdb2n04/pdb 25514 BMRB ? 10.13018/BMR25514 D_1000104253 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-13 2 'Structure model' 1 1 2016-08-10 3 'Structure model' 1 2 2016-08-24 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 10 5 'Structure model' pdbx_entry_details 11 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 4 'Structure model' '_struct_ref_seq_dif.details' 8 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N04 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-03-04 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 25514 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Patel, P.' 1 'Lian, L.' 2 'Morgan, A.' 3 'Burgoyne, R.' 4 # _citation.id primary _citation.title 'Phosphorylation of Cysteine String Protein Triggers a Major Conformational Switch.' _citation.journal_abbrev Structure _citation.journal_volume 24 _citation.page_first 1380 _citation.page_last 1386 _citation.year 2016 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27452402 _citation.pdbx_database_id_DOI 10.1016/j.str.2016.06.009 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Patel, P.' 1 ? primary 'Prescott, G.R.' 2 ? primary 'Burgoyne, R.D.' 3 ? primary 'Lian, L.Y.' 4 ? primary 'Morgan, A.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DnaJ homolog subfamily C member 5' _entity.formula_weight 11984.200 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cysteine string protein, CSP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MRSPGMADQRQRSL(SEP)TSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDAT KRNIYDKYGSLGLYVAEQFGEENVNTYFV ; _entity_poly.pdbx_seq_one_letter_code_can ;MRSPGMADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNI YDKYGSLGLYVAEQFGEENVNTYFV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 SER n 1 4 PRO n 1 5 GLY n 1 6 MET n 1 7 ALA n 1 8 ASP n 1 9 GLN n 1 10 ARG n 1 11 GLN n 1 12 ARG n 1 13 SER n 1 14 LEU n 1 15 SEP n 1 16 THR n 1 17 SER n 1 18 GLY n 1 19 GLU n 1 20 SER n 1 21 LEU n 1 22 TYR n 1 23 HIS n 1 24 VAL n 1 25 LEU n 1 26 GLY n 1 27 LEU n 1 28 ASP n 1 29 LYS n 1 30 ASN n 1 31 ALA n 1 32 THR n 1 33 SER n 1 34 ASP n 1 35 ASP n 1 36 ILE n 1 37 LYS n 1 38 LYS n 1 39 SER n 1 40 TYR n 1 41 ARG n 1 42 LYS n 1 43 LEU n 1 44 ALA n 1 45 LEU n 1 46 LYS n 1 47 TYR n 1 48 HIS n 1 49 PRO n 1 50 ASP n 1 51 LYS n 1 52 ASN n 1 53 PRO n 1 54 ASP n 1 55 ASN n 1 56 PRO n 1 57 GLU n 1 58 ALA n 1 59 ALA n 1 60 ASP n 1 61 LYS n 1 62 PHE n 1 63 LYS n 1 64 GLU n 1 65 ILE n 1 66 ASN n 1 67 ASN n 1 68 ALA n 1 69 HIS n 1 70 ALA n 1 71 ILE n 1 72 LEU n 1 73 THR n 1 74 ASP n 1 75 ALA n 1 76 THR n 1 77 LYS n 1 78 ARG n 1 79 ASN n 1 80 ILE n 1 81 TYR n 1 82 ASP n 1 83 LYS n 1 84 TYR n 1 85 GLY n 1 86 SER n 1 87 LEU n 1 88 GLY n 1 89 LEU n 1 90 TYR n 1 91 VAL n 1 92 ALA n 1 93 GLU n 1 94 GLN n 1 95 PHE n 1 96 GLY n 1 97 GLU n 1 98 GLU n 1 99 ASN n 1 100 VAL n 1 101 ASN n 1 102 THR n 1 103 TYR n 1 104 PHE n 1 105 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DNAJC5, CSP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pE-Sumo Pro Kan' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -4 -4 MET MET A . n A 1 2 ARG 2 -3 -3 ARG ARG A . n A 1 3 SER 3 -2 -2 SER SER A . n A 1 4 PRO 4 -1 -1 PRO PRO A . n A 1 5 GLY 5 0 0 GLY GLY A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 ALA 7 2 2 ALA ALA A . n A 1 8 ASP 8 3 3 ASP ASP A . n A 1 9 GLN 9 4 4 GLN GLN A . n A 1 10 ARG 10 5 5 ARG ARG A . n A 1 11 GLN 11 6 6 GLN GLN A . n A 1 12 ARG 12 7 7 ARG ARG A . n A 1 13 SER 13 8 8 SER SER A . n A 1 14 LEU 14 9 9 LEU LEU A . n A 1 15 SEP 15 10 10 SEP SEP A . n A 1 16 THR 16 11 11 THR THR A . n A 1 17 SER 17 12 12 SER SER A . n A 1 18 GLY 18 13 13 GLY GLY A . n A 1 19 GLU 19 14 14 GLU GLU A . n A 1 20 SER 20 15 15 SER SER A . n A 1 21 LEU 21 16 16 LEU LEU A . n A 1 22 TYR 22 17 17 TYR TYR A . n A 1 23 HIS 23 18 18 HIS HIS A . n A 1 24 VAL 24 19 19 VAL VAL A . n A 1 25 LEU 25 20 20 LEU LEU A . n A 1 26 GLY 26 21 21 GLY GLY A . n A 1 27 LEU 27 22 22 LEU LEU A . n A 1 28 ASP 28 23 23 ASP ASP A . n A 1 29 LYS 29 24 24 LYS LYS A . n A 1 30 ASN 30 25 25 ASN ASN A . n A 1 31 ALA 31 26 26 ALA ALA A . n A 1 32 THR 32 27 27 THR THR A . n A 1 33 SER 33 28 28 SER SER A . n A 1 34 ASP 34 29 29 ASP ASP A . n A 1 35 ASP 35 30 30 ASP ASP A . n A 1 36 ILE 36 31 31 ILE ILE A . n A 1 37 LYS 37 32 32 LYS LYS A . n A 1 38 LYS 38 33 33 LYS LYS A . n A 1 39 SER 39 34 34 SER SER A . n A 1 40 TYR 40 35 35 TYR TYR A . n A 1 41 ARG 41 36 36 ARG ARG A . n A 1 42 LYS 42 37 37 LYS LYS A . n A 1 43 LEU 43 38 38 LEU LEU A . n A 1 44 ALA 44 39 39 ALA ALA A . n A 1 45 LEU 45 40 40 LEU LEU A . n A 1 46 LYS 46 41 41 LYS LYS A . n A 1 47 TYR 47 42 42 TYR TYR A . n A 1 48 HIS 48 43 43 HIS HIS A . n A 1 49 PRO 49 44 44 PRO PRO A . n A 1 50 ASP 50 45 45 ASP ASP A . n A 1 51 LYS 51 46 46 LYS LYS A . n A 1 52 ASN 52 47 47 ASN ASN A . n A 1 53 PRO 53 48 48 PRO PRO A . n A 1 54 ASP 54 49 49 ASP ASP A . n A 1 55 ASN 55 50 50 ASN ASN A . n A 1 56 PRO 56 51 51 PRO PRO A . n A 1 57 GLU 57 52 52 GLU GLU A . n A 1 58 ALA 58 53 53 ALA ALA A . n A 1 59 ALA 59 54 54 ALA ALA A . n A 1 60 ASP 60 55 55 ASP ASP A . n A 1 61 LYS 61 56 56 LYS LYS A . n A 1 62 PHE 62 57 57 PHE PHE A . n A 1 63 LYS 63 58 58 LYS LYS A . n A 1 64 GLU 64 59 59 GLU GLU A . n A 1 65 ILE 65 60 60 ILE ILE A . n A 1 66 ASN 66 61 61 ASN ASN A . n A 1 67 ASN 67 62 62 ASN ASN A . n A 1 68 ALA 68 63 63 ALA ALA A . n A 1 69 HIS 69 64 64 HIS HIS A . n A 1 70 ALA 70 65 65 ALA ALA A . n A 1 71 ILE 71 66 66 ILE ILE A . n A 1 72 LEU 72 67 67 LEU LEU A . n A 1 73 THR 73 68 68 THR THR A . n A 1 74 ASP 74 69 69 ASP ASP A . n A 1 75 ALA 75 70 70 ALA ALA A . n A 1 76 THR 76 71 71 THR THR A . n A 1 77 LYS 77 72 72 LYS LYS A . n A 1 78 ARG 78 73 73 ARG ARG A . n A 1 79 ASN 79 74 74 ASN ASN A . n A 1 80 ILE 80 75 75 ILE ILE A . n A 1 81 TYR 81 76 76 TYR TYR A . n A 1 82 ASP 82 77 77 ASP ASP A . n A 1 83 LYS 83 78 78 LYS LYS A . n A 1 84 TYR 84 79 79 TYR TYR A . n A 1 85 GLY 85 80 80 GLY GLY A . n A 1 86 SER 86 81 81 SER SER A . n A 1 87 LEU 87 82 82 LEU LEU A . n A 1 88 GLY 88 83 83 GLY GLY A . n A 1 89 LEU 89 84 84 LEU LEU A . n A 1 90 TYR 90 85 85 TYR TYR A . n A 1 91 VAL 91 86 86 VAL VAL A . n A 1 92 ALA 92 87 87 ALA ALA A . n A 1 93 GLU 93 88 88 GLU GLU A . n A 1 94 GLN 94 89 89 GLN GLN A . n A 1 95 PHE 95 90 90 PHE PHE A . n A 1 96 GLY 96 91 91 GLY GLY A . n A 1 97 GLU 97 92 92 GLU GLU A . n A 1 98 GLU 98 93 93 GLU GLU A . n A 1 99 ASN 99 94 94 ASN ASN A . n A 1 100 VAL 100 95 95 VAL VAL A . n A 1 101 ASN 101 96 96 ASN ASN A . n A 1 102 THR 102 97 97 THR THR A . n A 1 103 TYR 103 98 98 TYR TYR A . n A 1 104 PHE 104 99 99 PHE PHE A . n A 1 105 VAL 105 100 100 VAL VAL A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N04 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N04 _struct.title 'Solution Structure of the phosphorylated N-terminal region of Human Cysteine String Protein (CSP)' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N04 _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text 'phosphorylation, DnaJ, CHAPERONE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNJC5_HUMAN _struct_ref.pdbx_db_accession Q9H3Z4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYG SLGLYVAEQFGEENVNTYFV ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N04 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H3Z4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 100 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 100 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N04 MET A 1 ? UNP Q9H3Z4 ? ? 'expression tag' -4 1 1 2N04 ARG A 2 ? UNP Q9H3Z4 ? ? 'expression tag' -3 2 1 2N04 SER A 3 ? UNP Q9H3Z4 ? ? 'expression tag' -2 3 1 2N04 PRO A 4 ? UNP Q9H3Z4 ? ? 'expression tag' -1 4 1 2N04 GLY A 5 ? UNP Q9H3Z4 ? ? 'expression tag' 0 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 17 ? GLU A 19 ? SER A 12 GLU A 14 5 ? 3 HELX_P HELX_P2 2 SER A 20 ? GLY A 26 ? SER A 15 GLY A 21 1 ? 7 HELX_P HELX_P3 3 ASP A 34 ? HIS A 48 ? ASP A 29 HIS A 43 1 ? 15 HELX_P HELX_P4 4 ASN A 55 ? LEU A 72 ? ASN A 50 LEU A 67 1 ? 18 HELX_P HELX_P5 5 ASP A 74 ? ASP A 82 ? ASP A 69 ASP A 77 1 ? 9 HELX_P HELX_P6 6 GLY A 85 ? GLU A 93 ? GLY A 80 GLU A 88 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 14 C ? ? ? 1_555 A SEP 15 N ? ? A LEU 9 A SEP 10 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale2 covale both ? A SEP 15 C ? ? ? 1_555 A THR 16 N ? ? A SEP 10 A THR 11 1_555 ? ? ? ? ? ? ? 1.316 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id SEP _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 15 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id SEP _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 10 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id SER _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id SEP _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # _pdbx_entry_details.entry_id 2N04 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG A LEU 22 ? ? HD11 A ILE 31 ? ? 1.24 2 2 HG A LEU 22 ? ? HD11 A ILE 31 ? ? 1.32 3 3 HG A LEU 22 ? ? HD13 A ILE 31 ? ? 1.24 4 3 HB3 A GLN 6 ? ? HD23 A LEU 82 ? ? 1.35 5 4 OD1 A ASP 55 ? ? HZ1 A LYS 58 ? ? 1.54 6 4 O A LEU 84 ? ? H A GLU 88 ? ? 1.57 7 6 HG A LEU 22 ? ? HD11 A ILE 31 ? ? 1.30 8 6 HD1 A HIS 64 ? ? OE1 A GLU 88 ? ? 1.59 9 7 HE2 A LYS 32 ? ? HA A ALA 65 ? ? 1.29 10 7 HG A LEU 22 ? ? HD12 A ILE 31 ? ? 1.32 11 8 HG A LEU 22 ? ? HD13 A ILE 31 ? ? 1.34 12 9 HG A LEU 22 ? ? HD12 A ILE 31 ? ? 1.31 13 12 HG A LEU 22 ? ? HD12 A ILE 31 ? ? 1.31 14 13 H3 A MET -4 ? ? OD2 A ASP 3 ? ? 1.58 15 13 HD1 A HIS 64 ? ? OE1 A GLU 88 ? ? 1.60 16 15 HG A LEU 22 ? ? HD13 A ILE 31 ? ? 1.27 17 15 O A LEU 84 ? ? H A GLU 88 ? ? 1.58 18 16 HG A LEU 22 ? ? HD13 A ILE 31 ? ? 1.29 19 17 HG A LEU 22 ? ? HD13 A ILE 31 ? ? 1.27 20 17 OD2 A ASP 55 ? ? HZ1 A LYS 58 ? ? 1.58 21 18 HG A LEU 22 ? ? HD11 A ILE 31 ? ? 1.27 22 18 HE22 A GLN 6 ? ? HD1 A TYR 79 ? ? 1.30 23 19 HG A LEU 22 ? ? HD11 A ILE 31 ? ? 1.24 24 20 HG A LEU 22 ? ? HD12 A ILE 31 ? ? 1.33 25 20 OD1 A ASP 23 ? ? HH12 A ARG 73 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 8 ? ? -95.58 -76.94 2 1 ASP A 23 ? ? -179.92 109.67 3 1 LYS A 24 ? ? 47.77 5.14 4 1 PHE A 90 ? ? -130.03 -39.96 5 2 ASP A 3 ? ? -49.59 151.69 6 2 SER A 8 ? ? -99.35 -77.37 7 2 LEU A 9 ? ? -110.86 -165.05 8 2 ASP A 23 ? ? -178.30 112.96 9 2 LYS A 24 ? ? 51.47 7.87 10 3 MET A 1 ? ? 64.42 -166.07 11 3 GLN A 6 ? ? 71.64 166.97 12 3 SER A 8 ? ? -127.04 -77.59 13 3 LEU A 9 ? ? -108.47 -165.54 14 3 ASP A 23 ? ? 179.52 108.65 15 3 LYS A 24 ? ? 46.31 8.83 16 4 ARG A -3 ? ? 63.67 -170.84 17 4 GLN A 6 ? ? 66.37 109.81 18 4 ASP A 23 ? ? -178.94 110.53 19 4 LYS A 24 ? ? 47.91 7.17 20 4 ASN A 62 ? ? -60.16 -70.08 21 5 ARG A -3 ? ? 179.99 84.73 22 5 GLN A 6 ? ? 66.87 101.89 23 5 SER A 8 ? ? -98.39 -90.22 24 5 ASP A 23 ? ? -173.43 107.43 25 5 LYS A 24 ? ? 44.74 7.38 26 6 MET A 1 ? ? 56.95 70.60 27 6 GLN A 6 ? ? 67.99 120.79 28 6 ASP A 23 ? ? -176.25 109.38 29 6 LYS A 24 ? ? 47.51 9.09 30 7 GLN A 6 ? ? 70.63 104.03 31 7 SER A 8 ? ? -102.51 -95.83 32 7 ASP A 23 ? ? -179.06 108.87 33 7 LYS A 24 ? ? 47.99 8.53 34 7 ASN A 94 ? ? -101.78 -66.99 35 7 PHE A 99 ? ? -46.94 164.15 36 8 GLN A 6 ? ? 68.59 157.29 37 8 SER A 8 ? ? -106.88 -60.88 38 8 LEU A 9 ? ? -129.13 -165.03 39 8 ASP A 23 ? ? -179.21 109.98 40 8 LYS A 24 ? ? 48.94 7.89 41 8 PHE A 90 ? ? -130.72 -41.65 42 9 ARG A -3 ? ? 65.97 155.09 43 9 SER A 8 ? ? -99.71 -85.93 44 9 ASP A 23 ? ? -179.66 116.33 45 9 LYS A 24 ? ? 49.25 9.63 46 9 LYS A 78 ? ? -107.44 -60.49 47 9 ASN A 94 ? ? -101.85 -61.14 48 10 MET A 1 ? ? 66.28 -80.31 49 10 GLN A 6 ? ? 68.72 144.46 50 10 SER A 8 ? ? -101.47 -74.43 51 10 LEU A 9 ? ? -101.97 -167.04 52 10 ASP A 23 ? ? -173.49 107.61 53 10 LYS A 24 ? ? 46.15 7.19 54 11 ARG A -3 ? ? 68.51 100.62 55 11 GLN A 6 ? ? 63.96 147.08 56 11 SER A 8 ? ? -101.33 -86.09 57 11 ASP A 23 ? ? -175.28 108.73 58 11 LYS A 24 ? ? 46.58 5.77 59 12 ARG A 7 ? ? -140.36 -2.99 60 12 SER A 8 ? ? -96.53 -88.56 61 12 ASP A 23 ? ? -177.04 109.14 62 12 LYS A 24 ? ? 47.15 8.43 63 12 LYS A 78 ? ? -104.34 -60.55 64 13 ARG A -3 ? ? -135.16 -37.77 65 13 GLN A 6 ? ? 58.61 99.83 66 13 SER A 8 ? ? -99.72 -87.88 67 13 ASP A 23 ? ? -177.46 109.25 68 13 LYS A 24 ? ? 47.01 10.75 69 13 LYS A 78 ? ? -107.04 -60.79 70 13 PHE A 99 ? ? 44.27 -166.33 71 14 ARG A -3 ? ? 60.18 -160.99 72 14 MET A 1 ? ? -170.50 130.76 73 14 GLN A 6 ? ? 71.20 103.09 74 14 SER A 8 ? ? -96.57 -82.88 75 14 ASP A 23 ? ? -179.55 108.67 76 14 LYS A 24 ? ? 46.47 8.15 77 14 ARG A 36 ? ? -58.23 -70.35 78 14 ASN A 94 ? ? -101.09 -66.41 79 15 GLN A 6 ? ? 72.58 100.84 80 15 ASP A 23 ? ? -178.54 108.77 81 15 LYS A 24 ? ? 47.03 8.48 82 16 ARG A -3 ? ? -139.78 -40.80 83 16 GLN A 6 ? ? 65.24 108.04 84 16 SER A 8 ? ? -97.09 -80.64 85 16 ASP A 23 ? ? 179.89 110.07 86 16 LYS A 24 ? ? 51.13 8.38 87 16 LYS A 78 ? ? -102.65 -61.29 88 17 MET A 1 ? ? 71.85 145.40 89 17 GLN A 6 ? ? 71.24 121.40 90 17 SER A 8 ? ? -98.99 -75.53 91 17 LEU A 9 ? ? -108.11 -165.12 92 17 ASP A 23 ? ? -179.56 109.33 93 17 LYS A 24 ? ? 47.01 8.69 94 17 PHE A 90 ? ? -133.96 -42.15 95 18 ARG A -3 ? ? -90.55 56.95 96 18 GLN A 6 ? ? 76.78 141.70 97 18 SER A 8 ? ? -123.84 -81.72 98 18 LEU A 9 ? ? -103.10 -165.07 99 18 ASP A 23 ? ? -176.93 109.15 100 18 LYS A 24 ? ? 47.46 8.25 101 18 LYS A 78 ? ? -107.31 -60.61 102 18 PHE A 90 ? ? -130.22 -41.22 103 19 GLN A 6 ? ? 68.52 105.21 104 19 SER A 8 ? ? -96.40 -68.44 105 19 LEU A 9 ? ? -103.11 -167.21 106 19 ASP A 23 ? ? 179.34 110.06 107 19 LYS A 24 ? ? 51.78 7.95 108 19 ASN A 94 ? ? -100.78 -67.26 109 19 PHE A 99 ? ? 40.11 -156.37 110 20 SER A 8 ? ? -99.60 -88.24 111 20 ASP A 23 ? ? 179.80 112.29 112 20 LYS A 24 ? ? 51.43 7.69 113 20 LYS A 78 ? ? -102.11 -61.75 114 20 ASN A 94 ? ? -101.33 -62.25 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 6 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 79 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.052 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 15 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 10 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details PHOSPHOSERINE # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N04 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N04 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents ;0.5 mM [U-13C; U-15N] Phosphorylated DnaJ domain of cysteine-string protein, 20 mM MES, 150 mM sodium chloride, 1 mM DTT, 10 mM MgCl2, 0.5 mM EDTA, 0.73 nM PKA, 1 mM ATP, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Phosphorylated DnaJ domain of cysteine-string protein-1' 0.5 ? mM '[U-13C; U-15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 150 ? mM ? 1 DTT-4 1 ? mM ? 1 MgCl2-5 10 ? mM ? 1 EDTA-6 0.5 ? mM ? 1 PKA-7 0.00073 ? uM ? 1 ATP-8 1 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '3D HNCA' 1 5 1 '3D HN(CO)CA' 1 6 1 '3D HNCACB' 1 7 1 '3D CBCA(CO)NH' 1 8 1 '3D HNCO' 1 9 1 '3D HCACO' 1 10 1 '3D HBHANH' 1 11 1 '3D HBHA(CO)NH' 1 12 1 '3D HCCH-TOCSY' 1 13 1 '3D 1H-15N NOESY' 1 14 1 '3D 1H-13C NOESY' 1 15 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_refine.entry_id 2N04 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Bruker Biospin' processing TopSpin ? 2 CCPN 'chemical shift assignment' CCPN_Analysis ? 3 CCPN 'peak picking' CCPN_Analysis ? 4 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA ? 5 ;Linge, O'Donoghue and Nilges ; refinement ARIA ? 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SEP N N N N 273 SEP CA C N S 274 SEP CB C N N 275 SEP OG O N N 276 SEP C C N N 277 SEP O O N N 278 SEP OXT O N N 279 SEP P P N N 280 SEP O1P O N N 281 SEP O2P O N N 282 SEP O3P O N N 283 SEP H H N N 284 SEP H2 H N N 285 SEP HA H N N 286 SEP HB2 H N N 287 SEP HB3 H N N 288 SEP HXT H N N 289 SEP HOP2 H N N 290 SEP HOP3 H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TYR N N N N 323 TYR CA C N S 324 TYR C C N N 325 TYR O O N N 326 TYR CB C N N 327 TYR CG C Y N 328 TYR CD1 C Y N 329 TYR CD2 C Y N 330 TYR CE1 C Y N 331 TYR CE2 C Y N 332 TYR CZ C Y N 333 TYR OH O N N 334 TYR OXT O N N 335 TYR H H N N 336 TYR H2 H N N 337 TYR HA H N N 338 TYR HB2 H N N 339 TYR HB3 H N N 340 TYR HD1 H N N 341 TYR HD2 H N N 342 TYR HE1 H N N 343 TYR HE2 H N N 344 TYR HH H N N 345 TYR HXT H N N 346 VAL N N N N 347 VAL CA C N S 348 VAL C C N N 349 VAL O O N N 350 VAL CB C N N 351 VAL CG1 C N N 352 VAL CG2 C N N 353 VAL OXT O N N 354 VAL H H N N 355 VAL H2 H N N 356 VAL HA H N N 357 VAL HB H N N 358 VAL HG11 H N N 359 VAL HG12 H N N 360 VAL HG13 H N N 361 VAL HG21 H N N 362 VAL HG22 H N N 363 VAL HG23 H N N 364 VAL HXT H N N 365 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SEP N CA sing N N 262 SEP N H sing N N 263 SEP N H2 sing N N 264 SEP CA CB sing N N 265 SEP CA C sing N N 266 SEP CA HA sing N N 267 SEP CB OG sing N N 268 SEP CB HB2 sing N N 269 SEP CB HB3 sing N N 270 SEP OG P sing N N 271 SEP C O doub N N 272 SEP C OXT sing N N 273 SEP OXT HXT sing N N 274 SEP P O1P doub N N 275 SEP P O2P sing N N 276 SEP P O3P sing N N 277 SEP O2P HOP2 sing N N 278 SEP O3P HOP3 sing N N 279 SER N CA sing N N 280 SER N H sing N N 281 SER N H2 sing N N 282 SER CA C sing N N 283 SER CA CB sing N N 284 SER CA HA sing N N 285 SER C O doub N N 286 SER C OXT sing N N 287 SER CB OG sing N N 288 SER CB HB2 sing N N 289 SER CB HB3 sing N N 290 SER OG HG sing N N 291 SER OXT HXT sing N N 292 THR N CA sing N N 293 THR N H sing N N 294 THR N H2 sing N N 295 THR CA C sing N N 296 THR CA CB sing N N 297 THR CA HA sing N N 298 THR C O doub N N 299 THR C OXT sing N N 300 THR CB OG1 sing N N 301 THR CB CG2 sing N N 302 THR CB HB sing N N 303 THR OG1 HG1 sing N N 304 THR CG2 HG21 sing N N 305 THR CG2 HG22 sing N N 306 THR CG2 HG23 sing N N 307 THR OXT HXT sing N N 308 TYR N CA sing N N 309 TYR N H sing N N 310 TYR N H2 sing N N 311 TYR CA C sing N N 312 TYR CA CB sing N N 313 TYR CA HA sing N N 314 TYR C O doub N N 315 TYR C OXT sing N N 316 TYR CB CG sing N N 317 TYR CB HB2 sing N N 318 TYR CB HB3 sing N N 319 TYR CG CD1 doub Y N 320 TYR CG CD2 sing Y N 321 TYR CD1 CE1 sing Y N 322 TYR CD1 HD1 sing N N 323 TYR CD2 CE2 doub Y N 324 TYR CD2 HD2 sing N N 325 TYR CE1 CZ doub Y N 326 TYR CE1 HE1 sing N N 327 TYR CE2 CZ sing Y N 328 TYR CE2 HE2 sing N N 329 TYR CZ OH sing N N 330 TYR OH HH sing N N 331 TYR OXT HXT sing N N 332 VAL N CA sing N N 333 VAL N H sing N N 334 VAL N H2 sing N N 335 VAL CA C sing N N 336 VAL CA CB sing N N 337 VAL CA HA sing N N 338 VAL C O doub N N 339 VAL C OXT sing N N 340 VAL CB CG1 sing N N 341 VAL CB CG2 sing N N 342 VAL CB HB sing N N 343 VAL CG1 HG11 sing N N 344 VAL CG1 HG12 sing N N 345 VAL CG1 HG13 sing N N 346 VAL CG2 HG21 sing N N 347 VAL CG2 HG22 sing N N 348 VAL CG2 HG23 sing N N 349 VAL OXT HXT sing N N 350 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2N04 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_