data_2N0M # _entry.id 2N0M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104271 RCSB ? ? 2N0M PDB pdb_00002n0m 10.2210/pdb2n0m/pdb 18636 BMRB ? ? D_1000104271 WWPDB ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 18636 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N0M _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-03-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pauleta, S.R.' 1 'Matzapetakis, M.F.' 2 'Nobrega, C.F.' 3 'Carreira, C.' 4 'Saraiva, I.H.' 5 # _citation.id primary _citation.title ;The solution structure of the soluble form of the lipid-modified azurin from Neisseria gonorrhoeae, the electron donor of cytochrome c peroxidase. ; _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_volume 1857 _citation.page_first 169 _citation.page_last 176 _citation.year 2016 _citation.journal_id_ASTM BBACAQ _citation.country NE _citation.journal_id_ISSN 0006-3002 _citation.journal_id_CSD 0113 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26589091 _citation.pdbx_database_id_DOI 10.1016/j.bbabio.2015.11.006 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nobrega, C.S.' 1 ? primary 'Saraiva, I.H.' 2 ? primary 'Carreira, C.' 3 ? primary 'Devreese, B.' 4 ? primary 'Matzapetakis, M.' 5 ? primary 'Pauleta, S.R.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Lipid modified azurin protein' 13650.311 1 ? ? 'UNP residues 56-183' ? 2 non-polymer syn 'COPPER (I) ION' 63.546 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ATAGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDA RVVAHTKLIGGGEESSLTLDPAKLADGDYKFACTFPGHGALMNGKVTLVD ; _entity_poly.pdbx_seq_one_letter_code_can ;ATAGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDA RVVAHTKLIGGGEESSLTLDPAKLADGDYKFACTFPGHGALMNGKVTLVD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 ALA n 1 4 GLY n 1 5 ASN n 1 6 CYS n 1 7 ALA n 1 8 ALA n 1 9 THR n 1 10 VAL n 1 11 GLU n 1 12 SER n 1 13 ASN n 1 14 ASP n 1 15 ASN n 1 16 MET n 1 17 GLN n 1 18 PHE n 1 19 ASN n 1 20 THR n 1 21 LYS n 1 22 ASP n 1 23 ILE n 1 24 GLN n 1 25 VAL n 1 26 SER n 1 27 LYS n 1 28 ALA n 1 29 CYS n 1 30 LYS n 1 31 GLU n 1 32 PHE n 1 33 THR n 1 34 ILE n 1 35 THR n 1 36 LEU n 1 37 LYS n 1 38 HIS n 1 39 THR n 1 40 GLY n 1 41 THR n 1 42 GLN n 1 43 PRO n 1 44 LYS n 1 45 ALA n 1 46 SER n 1 47 MET n 1 48 GLY n 1 49 HIS n 1 50 ASN n 1 51 LEU n 1 52 VAL n 1 53 ILE n 1 54 ALA n 1 55 LYS n 1 56 ALA n 1 57 GLU n 1 58 ASP n 1 59 MET n 1 60 ASP n 1 61 GLY n 1 62 VAL n 1 63 PHE n 1 64 LYS n 1 65 ASP n 1 66 GLY n 1 67 VAL n 1 68 GLY n 1 69 ALA n 1 70 ALA n 1 71 ASP n 1 72 THR n 1 73 ASP n 1 74 TYR n 1 75 VAL n 1 76 LYS n 1 77 PRO n 1 78 ASP n 1 79 ASP n 1 80 ALA n 1 81 ARG n 1 82 VAL n 1 83 VAL n 1 84 ALA n 1 85 HIS n 1 86 THR n 1 87 LYS n 1 88 LEU n 1 89 ILE n 1 90 GLY n 1 91 GLY n 1 92 GLY n 1 93 GLU n 1 94 GLU n 1 95 SER n 1 96 SER n 1 97 LEU n 1 98 THR n 1 99 LEU n 1 100 ASP n 1 101 PRO n 1 102 ALA n 1 103 LYS n 1 104 LEU n 1 105 ALA n 1 106 ASP n 1 107 GLY n 1 108 ASP n 1 109 TYR n 1 110 LYS n 1 111 PHE n 1 112 ALA n 1 113 CYS n 1 114 THR n 1 115 PHE n 1 116 PRO n 1 117 GLY n 1 118 HIS n 1 119 GLY n 1 120 ALA n 1 121 LEU n 1 122 MET n 1 123 ASN n 1 124 GLY n 1 125 LYS n 1 126 VAL n 1 127 THR n 1 128 LEU n 1 129 VAL n 1 130 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NGO0994 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700825 / FA 1090' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Neisseria gonorrhoeae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 242231 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21-c _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5F809_NEIG1 _struct_ref.pdbx_db_accession Q5F809 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDARV VAHTKLIGGGEESSLTLDPAKLADGDYKFACTFPGHGALMNGKVTLVD ; _struct_ref.pdbx_align_begin 56 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N0M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5F809 _struct_ref_seq.db_align_beg 56 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 130 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N0M ALA A 1 ? UNP Q5F809 ? ? 'expression tag' 1 1 1 2N0M THR A 2 ? UNP Q5F809 ? ? 'expression tag' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU1 non-polymer . 'COPPER (I) ION' ? 'Cu 1' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' 1 3 1 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.5 mM [U-99% 13C; U-99% 15N] Laz, 20.0 mM sodium phosphate, 1.0 mM sodium azide, 5.0 mM sodium ascorbate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2N0M _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'Lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N0M _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N0M _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'JP Linge, M Habeck, W Rieping, M Nilges' 'automatic noe assignment' ARIA 2.3 1 'Brunger, A.T. et al.' 'structure calculation' CNS 1.21 2 CCPN 'spectrum display' 'CcpNmr Analysis' 2.4 3 CCPN 'spectrum analysis' 'CcpNmr Analysis' 2.4 4 'Bruker Biospin' 'data acquisition and processing' TopSpin 3.2 5 'Brunger, A.T. et al.' refinement CNS 1.21 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N0M _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N0M _struct.title 'The solution structure of the soluble form of the Lipid-modified Azurin from Neisseria gonorrhoeae' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N0M _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'Neisseria, copper protein, azurin-family, metal binding protein, electron transfer' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 43 ? GLY A 48 ? PRO A 43 GLY A 48 1 ? 6 HELX_P HELX_P2 2 ASP A 58 ? GLY A 68 ? ASP A 58 GLY A 68 1 ? 11 HELX_P HELX_P3 3 ALA A 69 ? ASP A 73 ? ALA A 69 ASP A 73 5 ? 5 HELX_P HELX_P4 4 ASP A 100 ? GLY A 107 ? ASP A 100 GLY A 107 5 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 49 ND1 ? ? ? 1_555 B CU1 . CU ? ? A HIS 49 A CU1 201 1_555 ? ? ? ? ? ? ? 2.065 ? ? metalc2 metalc ? ? A CYS 113 SG ? ? ? 1_555 B CU1 . CU ? ? A CYS 113 A CU1 201 1_555 ? ? ? ? ? ? ? 2.159 ? ? metalc3 metalc ? ? A HIS 118 ND1 ? ? ? 1_555 B CU1 . CU ? ? A HIS 118 A CU1 201 1_555 ? ? ? ? ? ? ? 2.059 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel B 1 2 ? parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 17 ? PHE A 18 ? GLN A 17 PHE A 18 A 2 ALA A 7 ? ASN A 13 ? ALA A 7 ASN A 13 A 3 PHE A 32 ? HIS A 38 ? PHE A 32 HIS A 38 A 4 GLU A 94 ? LEU A 99 ? GLU A 94 LEU A 99 B 1 ASP A 22 ? SER A 26 ? ASP A 22 SER A 26 B 2 LYS A 125 ? VAL A 129 ? LYS A 125 VAL A 129 C 1 VAL A 82 ? HIS A 85 ? VAL A 82 HIS A 85 C 2 VAL A 52 ? LYS A 55 ? VAL A 52 LYS A 55 C 3 TYR A 109 ? ALA A 112 ? TYR A 109 ALA A 112 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 17 ? O GLN A 17 N ASN A 13 ? N ASN A 13 A 2 3 N ALA A 8 ? N ALA A 8 O THR A 35 ? O THR A 35 A 3 4 N LEU A 36 ? N LEU A 36 O SER A 95 ? O SER A 95 B 1 2 N VAL A 25 ? N VAL A 25 O VAL A 129 ? O VAL A 129 C 1 2 O ALA A 84 ? O ALA A 84 N ILE A 53 ? N ILE A 53 C 2 3 N VAL A 52 ? N VAL A 52 O ALA A 112 ? O ALA A 112 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CU1 _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE CU1 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLY A 48 ? GLY A 48 . ? 1_555 ? 2 AC1 5 HIS A 49 ? HIS A 49 . ? 1_555 ? 3 AC1 5 CYS A 113 ? CYS A 113 . ? 1_555 ? 4 AC1 5 HIS A 118 ? HIS A 118 . ? 1_555 ? 5 AC1 5 MET A 122 ? MET A 122 . ? 1_555 ? # _atom_sites.entry_id 2N0M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 CYS 113 113 113 CYS CYS A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 ASP 130 130 130 ASP ASP A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CU1 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 131 _pdbx_nonpoly_scheme.pdb_mon_id CU1 _pdbx_nonpoly_scheme.auth_mon_id CU1 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 49 ? A HIS 49 ? 1_555 CU ? B CU1 . ? A CU1 201 ? 1_555 SG ? A CYS 113 ? A CYS 113 ? 1_555 126.6 ? 2 ND1 ? A HIS 49 ? A HIS 49 ? 1_555 CU ? B CU1 . ? A CU1 201 ? 1_555 ND1 ? A HIS 118 ? A HIS 118 ? 1_555 107.4 ? 3 SG ? A CYS 113 ? A CYS 113 ? 1_555 CU ? B CU1 . ? A CU1 201 ? 1_555 ND1 ? A HIS 118 ? A HIS 118 ? 1_555 125.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-01-20 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' pdbx_struct_conn_angle 6 2 'Structure model' struct_conn 7 2 'Structure model' struct_ref_seq_dif 8 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.value' 17 2 'Structure model' '_struct_conn.pdbx_dist_value' 18 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 2 'Structure model' '_struct_ref_seq_dif.details' 24 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 25 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 26 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Laz-1 1.5 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate-2' 20.0 ? mM ? 1 'sodium azide-3' 1.0 ? mM ? 1 'sodium ascorbate-4' 5.0 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count 1 _pdbx_nmr_constraints.entry_id 2N0M _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total ? _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 HZ3 A LYS 103 ? ? HH A TYR 109 ? ? 1.23 2 9 OD2 A ASP 73 ? ? HZ1 A LYS 87 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? -137.10 -36.61 2 1 ASN A 5 ? ? -161.67 92.98 3 1 MET A 16 ? ? 64.70 64.39 4 1 ALA A 69 ? ? -106.85 47.78 5 1 PRO A 77 ? ? -57.75 98.54 6 1 ASP A 78 ? ? -161.59 -60.85 7 2 ASN A 13 ? ? -124.27 -166.21 8 2 THR A 72 ? ? -94.87 -76.30 9 2 ASP A 73 ? ? -168.18 26.24 10 2 PRO A 77 ? ? -69.52 22.98 11 3 ASN A 5 ? ? -163.34 98.54 12 3 MET A 47 ? ? -164.87 83.18 13 3 THR A 72 ? ? -145.01 54.70 14 3 PRO A 77 ? ? -68.22 15.36 15 4 ASN A 13 ? ? -121.46 -166.96 16 4 ALA A 105 ? ? -92.64 39.64 17 5 THR A 2 ? ? -139.52 -62.66 18 5 ASN A 13 ? ? -122.50 -165.50 19 5 SER A 46 ? ? -121.93 -55.10 20 5 PRO A 77 ? ? -67.67 52.91 21 5 ASP A 79 ? ? 73.31 -37.57 22 5 MET A 122 ? ? -109.80 73.85 23 6 THR A 2 ? ? -97.39 -62.13 24 6 ASP A 106 ? ? -167.97 -34.08 25 6 PRO A 116 ? ? -51.16 107.79 26 7 MET A 47 ? ? -152.07 80.59 27 7 PRO A 77 ? ? -56.93 102.03 28 7 ASP A 78 ? ? -176.89 -51.43 29 7 ASP A 106 ? ? -116.98 66.71 30 8 MET A 16 ? ? 63.10 69.37 31 8 ALA A 69 ? ? -106.71 49.80 32 8 THR A 72 ? ? -117.38 52.63 33 8 PRO A 77 ? ? -68.53 68.89 34 8 ASP A 78 ? ? -153.97 -45.59 35 9 ASP A 73 ? ? 59.52 19.97 36 10 ALA A 3 ? ? 75.00 -19.55 37 10 THR A 72 ? ? -102.22 -89.92 38 10 ASP A 73 ? ? -143.65 35.09 39 10 PRO A 77 ? ? -71.76 30.60 40 10 ALA A 80 ? ? -104.46 -61.72 41 10 ALA A 105 ? ? -86.35 40.78 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'COPPER (I) ION' _pdbx_entity_nonpoly.comp_id CU1 #