data_2N1N # _entry.id 2N1N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104308 RCSB ? ? 2N1N PDB pdb_00002n1n 10.2210/pdb2n1n/pdb 25568 BMRB ? 10.13018/BMR25568 D_1000104308 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-02 2 'Structure model' 1 1 2016-10-12 3 'Structure model' 1 2 2024-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature 6 3 'Structure model' pdbx_nmr_software 7 3 'Structure model' pdbx_nmr_spectrometer 8 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N1N _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-04-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 1S6X PDB 'Solution structure of VSTx1' unspecified 25568 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lau, H.Y.' 1 'King, G.F.' 2 'Mobli, M.' 3 # _citation.id primary _citation.title 'Molecular basis of the interaction between gating modifier spider toxins and the voltage sensor of voltage-gated ion channels.' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 6 _citation.page_first 34333 _citation.page_last 34333 _citation.year ? _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27677715 _citation.pdbx_database_id_DOI 10.1038/srep34333 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lau, C.H.' 1 ? primary 'King, G.F.' 2 ? primary 'Mobli, M.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Kappa-theraphotoxin-Gr3a _entity.formula_weight 4096.843 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Kappa-TRTX-Gr3a, Voltage sensor toxin 1, VsTx1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF _entity_poly.pdbx_seq_one_letter_code_can SECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 CYS n 1 4 GLY n 1 5 LYS n 1 6 PHE n 1 7 MET n 1 8 TRP n 1 9 LYS n 1 10 CYS n 1 11 LYS n 1 12 ASN n 1 13 SER n 1 14 ASN n 1 15 ASP n 1 16 CYS n 1 17 CYS n 1 18 LYS n 1 19 ASP n 1 20 LEU n 1 21 VAL n 1 22 CYS n 1 23 SER n 1 24 SER n 1 25 ARG n 1 26 TRP n 1 27 LYS n 1 28 TRP n 1 29 CYS n 1 30 VAL n 1 31 LEU n 1 32 ALA n 1 33 SER n 1 34 PRO n 1 35 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Chilean red-back,Chilean rose tarantula' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Grammostola rosea' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 432528 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pLIC _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 PHE 35 35 35 PHE PHE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N1N _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N1N _struct.title 'Solution structure of VSTx1' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N1N _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VSTX1_GRARO _struct_ref.pdbx_db_accession P60980 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N1N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P60980 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 34 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 35 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2N1N _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P60980 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 17 SG ? ? A CYS 3 A CYS 17 1_555 ? ? ? ? ? ? ? 1.980 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 10 A CYS 22 1_555 ? ? ? ? ? ? ? 1.976 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 16 A CYS 29 1_555 ? ? ? ? ? ? ? 1.968 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 3 ? CYS A 17 ? CYS A 3 ? 1_555 CYS A 17 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 10 ? CYS A 22 ? CYS A 10 ? 1_555 CYS A 22 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 16 ? CYS A 29 ? CYS A 16 ? 1_555 CYS A 29 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 20 ? SER A 23 ? LEU A 20 SER A 23 A 2 TRP A 28 ? LEU A 31 ? TRP A 28 LEU A 31 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 21 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 21 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 30 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 30 # _pdbx_entry_details.entry_id 2N1N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 7 GLU A 2 ? ? -57.58 174.26 2 16 GLU A 2 ? ? -57.12 174.24 3 17 GLU A 2 ? ? -57.76 174.25 4 18 GLU A 2 ? ? -53.53 172.40 5 20 GLU A 2 ? ? -57.62 173.24 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N1N _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N1N _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '20 mM sodium acetate, 1.7 mM [U-99% 13C; U-99% 15N] VSTx1, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium acetate-1' 20 ? mM ? 1 VSTx1-2 1.7 ? mM '[U-99% 13C; U-99% 15N]' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCACB' 1 4 1 '3D HNCO' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '2D 1H-13C HSQC aliphatic' 1 7 1 '2D 1H-13C HSQC aromatic' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count 3 _pdbx_nmr_constraints.entry_id 2N1N _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 2 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 694 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 193 _pdbx_nmr_constraints.NOE_long_range_total_count 179 _pdbx_nmr_constraints.NOE_medium_range_total_count 116 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 206 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2N1N _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details 'Simulated annealing, with automated NOE assignment' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 'Bartels et al.' 'peak picking' XEASY ? 2 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 3 'Bruker Biospin' collection TopSpin ? 4 'Jeffrey C. Hoch and Alan S. Stern' processing Rowland_NMR_Toolkit 3 5 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 LEU N N N N 117 LEU CA C N S 118 LEU C C N N 119 LEU O O N N 120 LEU CB C N N 121 LEU CG C N N 122 LEU CD1 C N N 123 LEU CD2 C N N 124 LEU OXT O N N 125 LEU H H N N 126 LEU H2 H N N 127 LEU HA H N N 128 LEU HB2 H N N 129 LEU HB3 H N N 130 LEU HG H N N 131 LEU HD11 H N N 132 LEU HD12 H N N 133 LEU HD13 H N N 134 LEU HD21 H N N 135 LEU HD22 H N N 136 LEU HD23 H N N 137 LEU HXT H N N 138 LYS N N N N 139 LYS CA C N S 140 LYS C C N N 141 LYS O O N N 142 LYS CB C N N 143 LYS CG C N N 144 LYS CD C N N 145 LYS CE C N N 146 LYS NZ N N N 147 LYS OXT O N N 148 LYS H H N N 149 LYS H2 H N N 150 LYS HA H N N 151 LYS HB2 H N N 152 LYS HB3 H N N 153 LYS HG2 H N N 154 LYS HG3 H N N 155 LYS HD2 H N N 156 LYS HD3 H N N 157 LYS HE2 H N N 158 LYS HE3 H N N 159 LYS HZ1 H N N 160 LYS HZ2 H N N 161 LYS HZ3 H N N 162 LYS HXT H N N 163 MET N N N N 164 MET CA C N S 165 MET C C N N 166 MET O O N N 167 MET CB C N N 168 MET CG C N N 169 MET SD S N N 170 MET CE C N N 171 MET OXT O N N 172 MET H H N N 173 MET H2 H N N 174 MET HA H N N 175 MET HB2 H N N 176 MET HB3 H N N 177 MET HG2 H N N 178 MET HG3 H N N 179 MET HE1 H N N 180 MET HE2 H N N 181 MET HE3 H N N 182 MET HXT H N N 183 PHE N N N N 184 PHE CA C N S 185 PHE C C N N 186 PHE O O N N 187 PHE CB C N N 188 PHE CG C Y N 189 PHE CD1 C Y N 190 PHE CD2 C Y N 191 PHE CE1 C Y N 192 PHE CE2 C Y N 193 PHE CZ C Y N 194 PHE OXT O N N 195 PHE H H N N 196 PHE H2 H N N 197 PHE HA H N N 198 PHE HB2 H N N 199 PHE HB3 H N N 200 PHE HD1 H N N 201 PHE HD2 H N N 202 PHE HE1 H N N 203 PHE HE2 H N N 204 PHE HZ H N N 205 PHE HXT H N N 206 PRO N N N N 207 PRO CA C N S 208 PRO C C N N 209 PRO O O N N 210 PRO CB C N N 211 PRO CG C N N 212 PRO CD C N N 213 PRO OXT O N N 214 PRO H H N N 215 PRO HA H N N 216 PRO HB2 H N N 217 PRO HB3 H N N 218 PRO HG2 H N N 219 PRO HG3 H N N 220 PRO HD2 H N N 221 PRO HD3 H N N 222 PRO HXT H N N 223 SER N N N N 224 SER CA C N S 225 SER C C N N 226 SER O O N N 227 SER CB C N N 228 SER OG O N N 229 SER OXT O N N 230 SER H H N N 231 SER H2 H N N 232 SER HA H N N 233 SER HB2 H N N 234 SER HB3 H N N 235 SER HG H N N 236 SER HXT H N N 237 TRP N N N N 238 TRP CA C N S 239 TRP C C N N 240 TRP O O N N 241 TRP CB C N N 242 TRP CG C Y N 243 TRP CD1 C Y N 244 TRP CD2 C Y N 245 TRP NE1 N Y N 246 TRP CE2 C Y N 247 TRP CE3 C Y N 248 TRP CZ2 C Y N 249 TRP CZ3 C Y N 250 TRP CH2 C Y N 251 TRP OXT O N N 252 TRP H H N N 253 TRP H2 H N N 254 TRP HA H N N 255 TRP HB2 H N N 256 TRP HB3 H N N 257 TRP HD1 H N N 258 TRP HE1 H N N 259 TRP HE3 H N N 260 TRP HZ2 H N N 261 TRP HZ3 H N N 262 TRP HH2 H N N 263 TRP HXT H N N 264 VAL N N N N 265 VAL CA C N S 266 VAL C C N N 267 VAL O O N N 268 VAL CB C N N 269 VAL CG1 C N N 270 VAL CG2 C N N 271 VAL OXT O N N 272 VAL H H N N 273 VAL H2 H N N 274 VAL HA H N N 275 VAL HB H N N 276 VAL HG11 H N N 277 VAL HG12 H N N 278 VAL HG13 H N N 279 VAL HG21 H N N 280 VAL HG22 H N N 281 VAL HG23 H N N 282 VAL HXT H N N 283 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 LEU N CA sing N N 110 LEU N H sing N N 111 LEU N H2 sing N N 112 LEU CA C sing N N 113 LEU CA CB sing N N 114 LEU CA HA sing N N 115 LEU C O doub N N 116 LEU C OXT sing N N 117 LEU CB CG sing N N 118 LEU CB HB2 sing N N 119 LEU CB HB3 sing N N 120 LEU CG CD1 sing N N 121 LEU CG CD2 sing N N 122 LEU CG HG sing N N 123 LEU CD1 HD11 sing N N 124 LEU CD1 HD12 sing N N 125 LEU CD1 HD13 sing N N 126 LEU CD2 HD21 sing N N 127 LEU CD2 HD22 sing N N 128 LEU CD2 HD23 sing N N 129 LEU OXT HXT sing N N 130 LYS N CA sing N N 131 LYS N H sing N N 132 LYS N H2 sing N N 133 LYS CA C sing N N 134 LYS CA CB sing N N 135 LYS CA HA sing N N 136 LYS C O doub N N 137 LYS C OXT sing N N 138 LYS CB CG sing N N 139 LYS CB HB2 sing N N 140 LYS CB HB3 sing N N 141 LYS CG CD sing N N 142 LYS CG HG2 sing N N 143 LYS CG HG3 sing N N 144 LYS CD CE sing N N 145 LYS CD HD2 sing N N 146 LYS CD HD3 sing N N 147 LYS CE NZ sing N N 148 LYS CE HE2 sing N N 149 LYS CE HE3 sing N N 150 LYS NZ HZ1 sing N N 151 LYS NZ HZ2 sing N N 152 LYS NZ HZ3 sing N N 153 LYS OXT HXT sing N N 154 MET N CA sing N N 155 MET N H sing N N 156 MET N H2 sing N N 157 MET CA C sing N N 158 MET CA CB sing N N 159 MET CA HA sing N N 160 MET C O doub N N 161 MET C OXT sing N N 162 MET CB CG sing N N 163 MET CB HB2 sing N N 164 MET CB HB3 sing N N 165 MET CG SD sing N N 166 MET CG HG2 sing N N 167 MET CG HG3 sing N N 168 MET SD CE sing N N 169 MET CE HE1 sing N N 170 MET CE HE2 sing N N 171 MET CE HE3 sing N N 172 MET OXT HXT sing N N 173 PHE N CA sing N N 174 PHE N H sing N N 175 PHE N H2 sing N N 176 PHE CA C sing N N 177 PHE CA CB sing N N 178 PHE CA HA sing N N 179 PHE C O doub N N 180 PHE C OXT sing N N 181 PHE CB CG sing N N 182 PHE CB HB2 sing N N 183 PHE CB HB3 sing N N 184 PHE CG CD1 doub Y N 185 PHE CG CD2 sing Y N 186 PHE CD1 CE1 sing Y N 187 PHE CD1 HD1 sing N N 188 PHE CD2 CE2 doub Y N 189 PHE CD2 HD2 sing N N 190 PHE CE1 CZ doub Y N 191 PHE CE1 HE1 sing N N 192 PHE CE2 CZ sing Y N 193 PHE CE2 HE2 sing N N 194 PHE CZ HZ sing N N 195 PHE OXT HXT sing N N 196 PRO N CA sing N N 197 PRO N CD sing N N 198 PRO N H sing N N 199 PRO CA C sing N N 200 PRO CA CB sing N N 201 PRO CA HA sing N N 202 PRO C O doub N N 203 PRO C OXT sing N N 204 PRO CB CG sing N N 205 PRO CB HB2 sing N N 206 PRO CB HB3 sing N N 207 PRO CG CD sing N N 208 PRO CG HG2 sing N N 209 PRO CG HG3 sing N N 210 PRO CD HD2 sing N N 211 PRO CD HD3 sing N N 212 PRO OXT HXT sing N N 213 SER N CA sing N N 214 SER N H sing N N 215 SER N H2 sing N N 216 SER CA C sing N N 217 SER CA CB sing N N 218 SER CA HA sing N N 219 SER C O doub N N 220 SER C OXT sing N N 221 SER CB OG sing N N 222 SER CB HB2 sing N N 223 SER CB HB3 sing N N 224 SER OG HG sing N N 225 SER OXT HXT sing N N 226 TRP N CA sing N N 227 TRP N H sing N N 228 TRP N H2 sing N N 229 TRP CA C sing N N 230 TRP CA CB sing N N 231 TRP CA HA sing N N 232 TRP C O doub N N 233 TRP C OXT sing N N 234 TRP CB CG sing N N 235 TRP CB HB2 sing N N 236 TRP CB HB3 sing N N 237 TRP CG CD1 doub Y N 238 TRP CG CD2 sing Y N 239 TRP CD1 NE1 sing Y N 240 TRP CD1 HD1 sing N N 241 TRP CD2 CE2 doub Y N 242 TRP CD2 CE3 sing Y N 243 TRP NE1 CE2 sing Y N 244 TRP NE1 HE1 sing N N 245 TRP CE2 CZ2 sing Y N 246 TRP CE3 CZ3 doub Y N 247 TRP CE3 HE3 sing N N 248 TRP CZ2 CH2 doub Y N 249 TRP CZ2 HZ2 sing N N 250 TRP CZ3 CH2 sing Y N 251 TRP CZ3 HZ3 sing N N 252 TRP CH2 HH2 sing N N 253 TRP OXT HXT sing N N 254 VAL N CA sing N N 255 VAL N H sing N N 256 VAL N H2 sing N N 257 VAL CA C sing N N 258 VAL CA CB sing N N 259 VAL CA HA sing N N 260 VAL C O doub N N 261 VAL C OXT sing N N 262 VAL CB CG1 sing N N 263 VAL CB CG2 sing N N 264 VAL CB HB sing N N 265 VAL CG1 HG11 sing N N 266 VAL CG1 HG12 sing N N 267 VAL CG1 HG13 sing N N 268 VAL CG2 HG21 sing N N 269 VAL CG2 HG22 sing N N 270 VAL CG2 HG23 sing N N 271 VAL OXT HXT sing N N 272 # _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2N1N _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #