data_2N2M # _entry.id 2N2M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104343 RCSB ? ? 2N2M PDB pdb_00002n2m 10.2210/pdb2n2m/pdb 25281 BMRB ? ? D_1000104343 WWPDB ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2N2L unspecified . BMRB 25281 unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N2M _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-05-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Marassi, F.M.' 1 'Ding, Y.' 2 'Yao, Y.' 3 # _citation.id primary _citation.title ;Backbone structure of Yersinia pestis Ail determined in micelles by NMR-restrained simulated annealing with implicit membrane solvation. ; _citation.journal_abbrev J.Biomol.Nmr _citation.journal_volume 63 _citation.page_first 59 _citation.page_last 65 _citation.year 2015 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26143069 _citation.pdbx_database_id_DOI 10.1007/s10858-015-9963-2 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marassi, F.M.' 1 ? primary 'Ding, Y.' 2 ? primary 'Schwieters, C.D.' 3 ? primary 'Tian, Y.' 4 ? primary 'Yao, Y.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Outer membrane protein X' _entity.formula_weight 17492.400 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVDGFKLIDGDFKYYSVTAGPVFR INEYVSLYGLLGAGHGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF ; _entity_poly.pdbx_seq_one_letter_code_can ;EGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVDGFKLIDGDFKYYSVTAGPVFR INEYVSLYGLLGAGHGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLY n 1 3 GLU n 1 4 SER n 1 5 SER n 1 6 ILE n 1 7 SER n 1 8 ILE n 1 9 GLY n 1 10 TYR n 1 11 ALA n 1 12 GLN n 1 13 SER n 1 14 ARG n 1 15 VAL n 1 16 LYS n 1 17 GLU n 1 18 ASP n 1 19 GLY n 1 20 TYR n 1 21 LYS n 1 22 LEU n 1 23 ASP n 1 24 LYS n 1 25 ASN n 1 26 PRO n 1 27 ARG n 1 28 GLY n 1 29 PHE n 1 30 ASN n 1 31 LEU n 1 32 LYS n 1 33 TYR n 1 34 ARG n 1 35 TYR n 1 36 GLU n 1 37 PHE n 1 38 ASN n 1 39 ASN n 1 40 ASP n 1 41 TRP n 1 42 GLY n 1 43 VAL n 1 44 ILE n 1 45 GLY n 1 46 SER n 1 47 PHE n 1 48 ALA n 1 49 GLN n 1 50 THR n 1 51 ARG n 1 52 ARG n 1 53 GLY n 1 54 PHE n 1 55 GLU n 1 56 GLU n 1 57 SER n 1 58 VAL n 1 59 ASP n 1 60 GLY n 1 61 PHE n 1 62 LYS n 1 63 LEU n 1 64 ILE n 1 65 ASP n 1 66 GLY n 1 67 ASP n 1 68 PHE n 1 69 LYS n 1 70 TYR n 1 71 TYR n 1 72 SER n 1 73 VAL n 1 74 THR n 1 75 ALA n 1 76 GLY n 1 77 PRO n 1 78 VAL n 1 79 PHE n 1 80 ARG n 1 81 ILE n 1 82 ASN n 1 83 GLU n 1 84 TYR n 1 85 VAL n 1 86 SER n 1 87 LEU n 1 88 TYR n 1 89 GLY n 1 90 LEU n 1 91 LEU n 1 92 GLY n 1 93 ALA n 1 94 GLY n 1 95 HIS n 1 96 GLY n 1 97 LYS n 1 98 ALA n 1 99 LYS n 1 100 PHE n 1 101 SER n 1 102 SER n 1 103 ILE n 1 104 PHE n 1 105 GLY n 1 106 GLN n 1 107 SER n 1 108 GLU n 1 109 SER n 1 110 ARG n 1 111 SER n 1 112 LYS n 1 113 THR n 1 114 SER n 1 115 LEU n 1 116 ALA n 1 117 TYR n 1 118 GLY n 1 119 ALA n 1 120 GLY n 1 121 LEU n 1 122 GLN n 1 123 PHE n 1 124 ASN n 1 125 PRO n 1 126 HIS n 1 127 PRO n 1 128 ASN n 1 129 PHE n 1 130 VAL n 1 131 ILE n 1 132 ASP n 1 133 ALA n 1 134 SER n 1 135 TYR n 1 136 GLU n 1 137 TYR n 1 138 SER n 1 139 LYS n 1 140 LEU n 1 141 ASP n 1 142 ASP n 1 143 VAL n 1 144 LYS n 1 145 VAL n 1 146 GLY n 1 147 THR n 1 148 TRP n 1 149 MET n 1 150 LEU n 1 151 GLY n 1 152 ALA n 1 153 GLY n 1 154 TYR n 1 155 ARG n 1 156 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ompX, y1324' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Yersinia pestis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 632 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8D0Z7_YERPE _struct_ref.pdbx_db_accession Q8D0Z7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVDGFKLIDGDFKYYSVTAGPVFR INEYVSLYGLLGAGHGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF ; _struct_ref.pdbx_align_begin 39 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N2M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 156 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8D0Z7 _struct_ref_seq.db_align_beg 39 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 194 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 156 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCA' 1 3 1 '3D HNCACB' 1 4 1 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.4-0.5 mM [U-100% 13C; U-100% 15N] Yersinia pestis Ail, 20 mM sodium phosphate, 5 mM sodium chloride, 170 mM decyl-phosphocholine (DePC), 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2N2M _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'Structures were folded and refined using the standard nonbonded potential REPEL' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N2M _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N2M _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe 1 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'chemical shift assignment' NMRPipe 2 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 3 ? 'Cornilescu, Delaglio and Bax' 'chemical shift calculation' TALOS 4 ? 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 5 ? 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 6 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N2M _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N2M _struct.title 'NMR structure of yersinia pestis Ail (attachment invasion locus) in decylphosphocholine micelles' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N2M _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'membrane protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details 1 ? 1 ? 2 ? 1 ? 3 ? 1 ? 4 ? 1 ? 5 ? 1 ? 6 ? 1 ? 7 ? 1 ? 8 ? 1 ? # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id 1 1 SER A 4 ? VAL A 15 ? SER A 4 VAL A 15 2 1 ARG A 27 ? TYR A 35 ? ARG A 27 TYR A 35 3 1 GLY A 42 ? ARG A 51 ? GLY A 42 ARG A 51 4 1 LYS A 69 ? ARG A 80 ? LYS A 69 ARG A 80 5 1 VAL A 85 ? LYS A 99 ? VAL A 85 LYS A 99 6 1 SER A 109 ? PHE A 123 ? SER A 109 PHE A 123 7 1 VAL A 130 ? LYS A 139 ? VAL A 130 LYS A 139 8 1 LYS A 144 ? TYR A 154 ? LYS A 144 TYR A 154 # _atom_sites.entry_id 2N2M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 TRP 148 148 148 TRP TRP A . n A 1 149 MET 149 149 149 MET MET A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 PHE 156 156 156 PHE PHE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-07-22 2 'Structure model' 1 1 2015-10-07 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Yersinia pestis Ail-1' ? 0.4-0.5 mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 5 ? mM ? 1 'decyl-phosphocholine (DePC)-4' 170 ? mM ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 H3 A GLU 1 ? ? H A GLY 2 ? ? 1.29 2 6 HH21 A ARG 34 ? ? HE22 A GLN 122 ? ? 1.29 3 7 HH11 A ARG 34 ? ? HE22 A GLN 122 ? ? 1.30 4 8 HH12 A ARG 34 ? ? HH A TYR 88 ? ? 1.28 5 9 HD1 A HIS 126 ? ? H A ASN 128 ? ? 1.24 6 10 O A ASN 82 ? ? H A TYR 84 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 21 ? ? 50.17 178.17 2 1 ASN A 38 ? ? 41.05 -126.67 3 1 ASN A 39 ? ? -158.86 -55.02 4 1 LYS A 62 ? ? 55.44 164.55 5 1 ASP A 65 ? ? 46.41 -97.59 6 1 ASN A 82 ? ? -126.71 -137.30 7 1 TYR A 84 ? ? -154.35 20.04 8 2 LYS A 24 ? ? 55.09 -6.67 9 2 GLU A 36 ? ? 81.45 163.82 10 2 ASP A 40 ? ? 86.82 -66.14 11 2 PHE A 54 ? ? -112.11 73.71 12 2 ASP A 59 ? ? 76.91 -16.56 13 2 LYS A 62 ? ? 55.12 -165.97 14 2 ASN A 82 ? ? -127.86 -155.83 15 2 TYR A 84 ? ? -140.87 35.01 16 3 LYS A 24 ? ? 50.33 7.94 17 3 PHE A 54 ? ? -60.73 77.97 18 3 ASP A 59 ? ? 75.34 -50.88 19 3 ASP A 65 ? ? 58.97 1.94 20 3 GLU A 83 ? ? 56.54 1.80 21 4 LYS A 24 ? ? 53.62 -2.76 22 4 ASP A 59 ? ? 72.14 -48.38 23 4 ASP A 65 ? ? -61.06 70.08 24 4 ASP A 67 ? ? 55.34 13.55 25 4 ASN A 82 ? ? -154.67 38.87 26 4 GLU A 83 ? ? 72.57 -49.58 27 5 LYS A 21 ? ? 56.97 125.90 28 5 ASN A 38 ? ? -130.72 -64.80 29 5 ASN A 39 ? ? -168.92 -78.78 30 5 PHE A 61 ? ? 55.97 106.11 31 5 LYS A 62 ? ? -129.98 -123.94 32 5 ASP A 65 ? ? 44.07 -113.16 33 5 ASN A 82 ? ? 173.84 165.11 34 5 GLU A 83 ? ? 45.20 -92.17 35 5 TYR A 84 ? ? -144.31 37.71 36 6 LYS A 21 ? ? 41.37 -166.82 37 6 ASN A 38 ? ? 46.90 -174.76 38 6 ASP A 59 ? ? 41.50 -158.67 39 6 ASP A 65 ? ? 61.06 -70.94 40 6 ASN A 82 ? ? -161.74 41.84 41 6 GLU A 83 ? ? 67.28 -37.62 42 7 LYS A 21 ? ? -155.06 37.03 43 7 LYS A 24 ? ? 48.70 12.59 44 7 ASP A 59 ? ? 45.38 -177.55 45 7 PHE A 61 ? ? 42.73 25.03 46 7 ASP A 65 ? ? 37.63 -107.27 47 7 ASN A 82 ? ? 162.90 -73.87 48 7 GLU A 83 ? ? -67.71 64.14 49 8 LYS A 24 ? ? 55.63 -3.85 50 8 ASN A 38 ? ? -155.53 61.72 51 8 ASN A 39 ? ? 52.66 -138.76 52 8 ASP A 40 ? ? 38.68 -106.51 53 8 ASP A 59 ? ? 42.65 -167.56 54 8 ASP A 65 ? ? -65.50 -162.64 55 8 GLU A 83 ? ? 76.17 -21.03 56 9 LYS A 24 ? ? 55.59 -6.73 57 9 GLU A 36 ? ? 80.99 166.47 58 9 ASP A 40 ? ? -136.07 -38.46 59 9 ASN A 82 ? ? -134.73 -148.87 60 9 TYR A 84 ? ? -149.23 15.62 61 10 LYS A 21 ? ? -164.42 39.75 62 10 LYS A 24 ? ? 52.39 3.80 63 10 ASN A 38 ? ? -170.77 99.58 64 10 ASN A 39 ? ? 41.56 -117.78 65 10 ASP A 40 ? ? 43.10 -98.91 66 10 ASP A 59 ? ? -162.36 92.87 67 10 ASN A 82 ? ? -156.72 31.72 68 10 GLU A 83 ? ? 68.52 -42.66 #