data_2N3F # _entry.id 2N3F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104372 RCSB ? ? 2N3F PDB pdb_00002n3f 10.2210/pdb2n3f/pdb 25138 BMRB ? 10.13018/BMR25138 D_1000104372 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-09-07 2 'Structure model' 1 1 2017-06-07 3 'Structure model' 1 2 2018-02-14 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' citation_author 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_nmr_software 7 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_citation.page_first' 3 3 'Structure model' '_citation.page_last' 4 3 'Structure model' '_citation.pdbx_database_id_DOI' 5 3 'Structure model' '_citation.pdbx_database_id_PubMed' 6 3 'Structure model' '_citation.title' 7 3 'Structure model' '_citation_author.name' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' 10 4 'Structure model' '_pdbx_nmr_software.name' 11 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N3F _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-05-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 25138 BMRB . unspecified 2N3H PDB . unspecified 2N3G PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Deshmukh, M.' 1 'Chiliveri, S.' 2 # _citation.id primary _citation.title 'DRB4 dsRBD1 drives dsRNA recognition in Arabidopsis thaliana tasi/siRNA pathway.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 45 _citation.page_first 8551 _citation.page_last 8563 _citation.year 2017 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 1362-4962 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 28575480 _citation.pdbx_database_id_DOI 10.1093/nar/gkx481 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chiliveri, S.C.' 1 ? primary 'Aute, R.' 2 ? primary 'Rai, U.' 3 ? primary 'Deshmukh, M.V.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Double-stranded RNA-binding protein 4' _entity.formula_weight 16618.721 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'DRBM domains 1 and 2, residues 1-153' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'dsRNA-binding protein 4, AtDRB4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDHVYKGQLQAYALQHNLELPVYANEREGPPHAPRFRCNVTFCGQTFQSSEFFPTLKSAEHAAAKIAVASLTPQSPEGID VAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNGNS ; _entity_poly.pdbx_seq_one_letter_code_can ;MDHVYKGQLQAYALQHNLELPVYANEREGPPHAPRFRCNVTFCGQTFQSSEFFPTLKSAEHAAAKIAVASLTPQSPEGID VAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNGNS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 HIS n 1 4 VAL n 1 5 TYR n 1 6 LYS n 1 7 GLY n 1 8 GLN n 1 9 LEU n 1 10 GLN n 1 11 ALA n 1 12 TYR n 1 13 ALA n 1 14 LEU n 1 15 GLN n 1 16 HIS n 1 17 ASN n 1 18 LEU n 1 19 GLU n 1 20 LEU n 1 21 PRO n 1 22 VAL n 1 23 TYR n 1 24 ALA n 1 25 ASN n 1 26 GLU n 1 27 ARG n 1 28 GLU n 1 29 GLY n 1 30 PRO n 1 31 PRO n 1 32 HIS n 1 33 ALA n 1 34 PRO n 1 35 ARG n 1 36 PHE n 1 37 ARG n 1 38 CYS n 1 39 ASN n 1 40 VAL n 1 41 THR n 1 42 PHE n 1 43 CYS n 1 44 GLY n 1 45 GLN n 1 46 THR n 1 47 PHE n 1 48 GLN n 1 49 SER n 1 50 SER n 1 51 GLU n 1 52 PHE n 1 53 PHE n 1 54 PRO n 1 55 THR n 1 56 LEU n 1 57 LYS n 1 58 SER n 1 59 ALA n 1 60 GLU n 1 61 HIS n 1 62 ALA n 1 63 ALA n 1 64 ALA n 1 65 LYS n 1 66 ILE n 1 67 ALA n 1 68 VAL n 1 69 ALA n 1 70 SER n 1 71 LEU n 1 72 THR n 1 73 PRO n 1 74 GLN n 1 75 SER n 1 76 PRO n 1 77 GLU n 1 78 GLY n 1 79 ILE n 1 80 ASP n 1 81 VAL n 1 82 ALA n 1 83 TYR n 1 84 LYS n 1 85 ASN n 1 86 LEU n 1 87 LEU n 1 88 GLN n 1 89 GLU n 1 90 ILE n 1 91 ALA n 1 92 GLN n 1 93 LYS n 1 94 GLU n 1 95 SER n 1 96 SER n 1 97 LEU n 1 98 LEU n 1 99 PRO n 1 100 PHE n 1 101 TYR n 1 102 ALA n 1 103 THR n 1 104 ALA n 1 105 THR n 1 106 SER n 1 107 GLY n 1 108 PRO n 1 109 SER n 1 110 HIS n 1 111 ALA n 1 112 PRO n 1 113 THR n 1 114 PHE n 1 115 THR n 1 116 SER n 1 117 THR n 1 118 VAL n 1 119 GLU n 1 120 PHE n 1 121 ALA n 1 122 GLY n 1 123 LYS n 1 124 VAL n 1 125 PHE n 1 126 SER n 1 127 GLY n 1 128 GLU n 1 129 GLU n 1 130 ALA n 1 131 LYS n 1 132 THR n 1 133 LYS n 1 134 LYS n 1 135 LEU n 1 136 ALA n 1 137 GLU n 1 138 MET n 1 139 SER n 1 140 ALA n 1 141 ALA n 1 142 LYS n 1 143 VAL n 1 144 ALA n 1 145 PHE n 1 146 MET n 1 147 SER n 1 148 ILE n 1 149 LYS n 1 150 ASN n 1 151 GLY n 1 152 ASN n 1 153 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'mouse-ear cress,thale-cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DBR4, At3g62800, F26K9.230' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-30a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 MET 146 146 146 MET MET A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 SER 153 153 153 SER SER A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N3F _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N3F _struct.title 'Solution structure of both dsRBDs of DRB4 along with linker (viz. DRB4(1-153))' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N3F _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'RNAi, RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DRB4_ARATH _struct_ref.pdbx_db_accession Q8H1D4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDHVYKGQLQAYALQHNLELPVYANEREGPPHAPRFRCNVTFCGQTFQSSEFFPTLKSAEHAAAKIAVASLTPQSPEGID VAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNGNS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N3F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8H1D4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 153 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 153 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 4 ? HIS A 16 ? VAL A 4 HIS A 16 1 ? 13 HELX_P HELX_P2 2 THR A 55 ? THR A 72 ? THR A 55 THR A 72 1 ? 18 HELX_P HELX_P3 3 TYR A 83 ? GLU A 94 ? TYR A 83 GLU A 94 1 ? 12 HELX_P HELX_P4 4 THR A 132 ? ASN A 150 ? THR A 132 ASN A 150 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 22 ? ARG A 27 ? VAL A 22 ARG A 27 A 2 ARG A 35 ? PHE A 42 ? ARG A 35 PHE A 42 A 3 GLN A 45 ? PHE A 47 ? GLN A 45 PHE A 47 B 1 TYR A 101 ? SER A 106 ? TYR A 101 SER A 106 B 2 THR A 113 ? PHE A 120 ? THR A 113 PHE A 120 B 3 LYS A 123 ? SER A 126 ? LYS A 123 SER A 126 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 27 ? N ARG A 27 O THR A 41 ? O THR A 41 A 2 3 N PHE A 42 ? N PHE A 42 O GLN A 45 ? O GLN A 45 B 1 2 N ALA A 104 ? N ALA A 104 O THR A 115 ? O THR A 115 B 2 3 N PHE A 120 ? N PHE A 120 O LYS A 123 ? O LYS A 123 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 OD1 A ASN 85 ? ? HD12 A LEU 86 ? ? 1.42 2 8 HG A SER 49 ? ? H A GLU 51 ? ? 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 3 ? ? -69.94 15.42 2 1 VAL A 4 ? ? -37.84 -31.72 3 1 PRO A 30 ? ? -44.03 166.15 4 1 PRO A 73 ? ? -36.27 -26.17 5 1 SER A 75 ? ? -162.50 70.80 6 1 GLU A 77 ? ? -164.40 -37.95 7 1 ILE A 79 ? ? -68.47 10.04 8 1 ASP A 80 ? ? -94.04 40.43 9 1 VAL A 81 ? ? -138.52 -61.93 10 1 TYR A 83 ? ? -45.02 -16.82 11 1 SER A 96 ? ? -76.11 -133.49 12 1 PRO A 99 ? ? -46.78 174.41 13 1 LYS A 131 ? ? -77.04 36.74 14 2 ASP A 2 ? ? 43.26 -117.75 15 2 VAL A 4 ? ? -37.98 -26.46 16 2 ASN A 17 ? ? 46.12 72.12 17 2 PRO A 30 ? ? -42.71 169.04 18 2 THR A 72 ? ? -37.25 153.63 19 2 PRO A 73 ? ? -62.69 66.44 20 2 GLN A 74 ? ? 81.96 -123.75 21 2 SER A 75 ? ? -153.13 59.44 22 2 GLU A 77 ? ? 58.31 70.92 23 2 ILE A 79 ? ? -171.61 98.74 24 2 ASP A 80 ? ? 61.44 69.80 25 2 VAL A 81 ? ? -110.85 -71.05 26 2 TYR A 83 ? ? -45.38 -16.12 27 2 LEU A 98 ? ? -43.37 152.43 28 2 ALA A 121 ? ? 54.24 17.97 29 2 LYS A 131 ? ? -74.49 35.62 30 3 ASN A 17 ? ? 66.34 62.95 31 3 PRO A 30 ? ? -43.54 163.49 32 3 GLU A 77 ? ? 41.71 -165.86 33 3 ILE A 79 ? ? -155.19 63.85 34 3 VAL A 81 ? ? -118.30 -78.19 35 3 TYR A 83 ? ? -45.44 -15.31 36 3 SER A 95 ? ? 54.26 82.99 37 3 SER A 96 ? ? -147.21 43.29 38 3 LEU A 97 ? ? 70.77 101.31 39 3 LEU A 98 ? ? -45.39 150.34 40 3 LYS A 131 ? ? -82.24 32.36 41 4 VAL A 4 ? ? -124.65 -51.83 42 4 PRO A 30 ? ? -46.04 159.26 43 4 PRO A 73 ? ? -55.10 -144.26 44 4 GLN A 74 ? ? -106.16 48.47 45 4 GLU A 77 ? ? -38.80 121.95 46 4 ASP A 80 ? ? -151.59 76.43 47 4 VAL A 81 ? ? -125.97 -82.75 48 4 TYR A 83 ? ? -46.17 -14.25 49 4 LEU A 98 ? ? -43.24 152.57 50 4 ALA A 121 ? ? 55.29 15.53 51 4 LYS A 131 ? ? -78.92 34.42 52 5 HIS A 3 ? ? -173.56 82.13 53 5 ASN A 17 ? ? 59.78 72.36 54 5 PRO A 30 ? ? -44.83 161.60 55 5 PRO A 73 ? ? -75.64 -105.13 56 5 GLN A 74 ? ? -84.76 -139.71 57 5 SER A 75 ? ? 166.41 157.73 58 5 GLU A 77 ? ? -174.26 10.39 59 5 ILE A 79 ? ? -74.92 24.27 60 5 ASP A 80 ? ? 56.20 97.20 61 5 VAL A 81 ? ? -148.10 -62.73 62 5 TYR A 83 ? ? -48.71 -15.96 63 5 SER A 95 ? ? 52.20 74.12 64 5 LEU A 97 ? ? 69.65 115.01 65 5 LEU A 98 ? ? -43.98 155.78 66 5 LYS A 131 ? ? -76.69 33.55 67 6 VAL A 4 ? ? -131.47 -32.41 68 6 PRO A 30 ? ? -42.62 163.99 69 6 PRO A 73 ? ? -76.87 -73.30 70 6 GLU A 77 ? ? 32.94 -108.51 71 6 ASP A 80 ? ? 158.73 92.55 72 6 VAL A 81 ? ? -156.79 -45.53 73 6 TYR A 83 ? ? -43.25 -18.19 74 6 LEU A 98 ? ? -45.99 154.13 75 6 LYS A 131 ? ? -80.24 35.25 76 7 HIS A 3 ? ? 52.15 169.88 77 7 PRO A 30 ? ? -44.66 165.72 78 7 SER A 75 ? ? 176.13 -61.46 79 7 ASP A 80 ? ? -161.54 -78.99 80 7 VAL A 81 ? ? 74.10 -48.79 81 7 TYR A 83 ? ? -48.08 -16.40 82 7 LEU A 98 ? ? -44.60 152.75 83 7 ALA A 121 ? ? 55.42 16.89 84 7 LYS A 131 ? ? -81.69 35.12 85 8 ASP A 2 ? ? 46.31 13.66 86 8 VAL A 4 ? ? -39.01 -26.59 87 8 PRO A 30 ? ? -45.16 160.51 88 8 THR A 72 ? ? -39.41 99.78 89 8 PRO A 73 ? ? -56.03 -70.35 90 8 SER A 75 ? ? 64.93 67.33 91 8 ASP A 80 ? ? -33.92 -88.84 92 8 VAL A 81 ? ? 156.95 -94.94 93 8 TYR A 83 ? ? -40.81 -19.05 94 8 SER A 95 ? ? 76.31 85.26 95 8 SER A 96 ? ? -146.03 28.50 96 8 LEU A 97 ? ? 79.33 106.49 97 8 LEU A 98 ? ? -42.28 153.61 98 8 LYS A 131 ? ? -80.67 33.16 99 8 ASN A 150 ? ? 176.33 -36.37 100 9 VAL A 4 ? ? -137.51 -35.57 101 9 LEU A 20 ? ? -45.61 108.39 102 9 PRO A 30 ? ? -45.23 160.56 103 9 THR A 72 ? ? 30.43 101.37 104 9 GLU A 77 ? ? -148.08 -8.57 105 9 ILE A 79 ? ? 32.79 77.80 106 9 ASP A 80 ? ? -161.61 38.74 107 9 VAL A 81 ? ? 83.06 11.50 108 9 TYR A 83 ? ? -48.53 -15.33 109 9 SER A 95 ? ? 53.10 7.98 110 9 LEU A 98 ? ? -44.54 152.73 111 9 ALA A 121 ? ? 56.03 12.33 112 9 LYS A 131 ? ? -79.50 33.41 113 10 VAL A 4 ? ? -135.18 -34.84 114 10 GLU A 19 ? ? -37.94 123.56 115 10 PRO A 30 ? ? -44.01 160.64 116 10 THR A 72 ? ? 38.78 103.77 117 10 GLN A 74 ? ? -64.59 -166.47 118 10 PRO A 76 ? ? -73.70 -86.71 119 10 GLU A 77 ? ? 55.90 -82.70 120 10 ILE A 79 ? ? -167.92 -20.38 121 10 VAL A 81 ? ? -159.62 12.40 122 10 ALA A 82 ? ? -134.54 -124.92 123 10 LEU A 98 ? ? -45.10 154.07 124 10 ALA A 121 ? ? 52.65 19.95 125 10 LYS A 131 ? ? -78.85 34.21 126 10 ASN A 150 ? ? -138.69 -87.00 # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR ; 700 ;SHEET DETERMINATION METHOD: AUTHOR ; # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N3F _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N3F _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '500 uM [U-100% 15N] DRB4(1-153), 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '500 uM [U-100% 13C; U-100% 15N] DRB4(1-153), 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '250 uM [U-100% 15N] DRB4(1-153), 90% H2O/10% D2O' 3 '90% H2O/10% D2O' '500 uM [U-100% 15N] DRB4(1-153), 500 uM U-13C,1H MeOnly Ile, Leu, Val (rest 12C,1H); U-15N DRB4(1-153), 100% D2O' 4 '100% D2O' '500 uM [U-100% 15N] DRB4(1-153), 500 uM U-13C,1H MeOnly Ile, Leu, Val (rest 12C,1H); U-15N DRB4(1-153), 100% D2O' 5 '100% D2O' '500 uM [U-100% 13C; U-100% 15N] DRB4(1-153), filamentous virus, 18mg/mL, 90% H2O/10% D2O' 6 '90% H2O/10% D2O' '500 uM [U-10% 13C] DRB4(1-153), 90% H2O/10% D2O' 7 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'DRB4(1-153)-1' 500 ? uM '[U-100% 15N]' 1 'DRB4(1-153)-2' 500 ? uM '[U-100% 13C; U-100% 15N]' 2 'DRB4(1-153)-3' 250 ? uM '[U-100% 15N]' 3 'DRB4(1-153)-4' 500 ? uM '[U-100% 15N]' 4 'DRB4(1-153)-5' 500 ? uM 'U-13C,1H MeOnly Ile, Leu, Val (rest 12C,1H); U-15N' 4 'DRB4(1-153)-6' 500 ? uM '[U-100% 15N]' 5 'DRB4(1-153)-7' 500 ? uM 'U-13C,1H MeOnly Ile, Leu, Val (rest 12C,1H); U-15N' 5 'DRB4(1-153)-8' 500 ? uM '[U-100% 13C; U-100% 15N]' 6 'DRB4(1-153)-9' 500 ? uM '[U-10% 13C]' 7 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '3D HNCO' 1 3 2 '3D HN(CA)CO' 1 4 2 '3D HNCA' 1 5 2 '3D HN(CO)CA' 1 6 2 '3D HNCACB' 1 7 2 '3D HN(COCA)CB' 1 8 2 '2D 1H-13C HSQC' 1 9 2 '3D H(CCO)NH-TOCSY' 1 10 2 '3D (H)C(CO)NH-TOCSY' 1 11 2 '3D HCCH-TOCSY' 1 12 2 '3D HNHA' 1 13 7 '2D 1H-13C HSQC' 1 14 3 '2D 1H-13C HSQC' 1 15 4 '3D 1H-13C NOESY' 1 16 5 '2D 1H-15N HSQC' 1 17 5 '2D 1H-1H NOESY' 1 18 3 '2D 1H-15N HSQC' 1 19 6 '2D 1H-15N HSQC' 1 20 1 '3D 1H-15N NOESY' 1 21 2 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2N3F _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 2.1.6 1 'Bruker Biospin' processing TopSpin 2.1.6 2 'Keller and Wuthrich' 'chemical shift assignment' CARA 1.8.4 3 'Keller and Wuthrich' 'data analysis' CARA 1.8.4 4 'Keller and Wuthrich' 'peak picking' CARA 1.8.4 5 Goddard 'data analysis' Sparky ? 6 Goddard 'structure solution' Sparky ? 7 'Schwieters, Kuszewski, Tjandra and Clore' 'data analysis' Sparky ? 8 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' Sparky ? 9 Goddard 'data analysis' Sparky ? 10 Goddard 'structure solution' Sparky ? 11 'Schwieters, Kuszewski, Tjandra and Clore' 'data analysis' Sparky ? 12 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' Sparky ? 13 'Laskowski and MacArthur' 'structure validation' ProcheckNMR 3.5.4 14 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 15 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2N3F _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_