data_2N4G # _entry.id 2N4G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104409 RCSB ? ? 2N4G PDB pdb_00002n4g 10.2210/pdb2n4g/pdb 25667 BMRB ? 10.13018/BMR25667 D_1000104409 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-04-20 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N4G _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2015-06-17 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 25667 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jiang, L.' 1 'Zhao, J.' 2 'Hu, H.' 3 # _citation.id primary _citation.title 'Two mutations G335D and Q343R within the amyloidogenic core region of TDP-43 influence its aggregation and inclusion formation' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 6 _citation.page_first 23928 _citation.page_last 23928 _citation.year 2016 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27030292 _citation.pdbx_database_id_DOI 10.1038/srep23928 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jiang, L.L.' 1 ? primary 'Zhao, J.' 2 ? primary 'Yin, X.F.' 3 ? primary 'He, W.T.' 4 ? primary 'Yang, H.' 5 ? primary 'Che, M.X.' 6 ? primary 'Hu, H.Y.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TAR DNA-binding protein 43' _entity.formula_weight 5265.833 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 311-360' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name TDP-43 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MNFGAFSINPAMMAAAQAALQSSWDMMGMLASQQNQSGPSGNNQNQGNMQ _entity_poly.pdbx_seq_one_letter_code_can MNFGAFSINPAMMAAAQAALQSSWDMMGMLASQQNQSGPSGNNQNQGNMQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 PHE n 1 4 GLY n 1 5 ALA n 1 6 PHE n 1 7 SER n 1 8 ILE n 1 9 ASN n 1 10 PRO n 1 11 ALA n 1 12 MET n 1 13 MET n 1 14 ALA n 1 15 ALA n 1 16 ALA n 1 17 GLN n 1 18 ALA n 1 19 ALA n 1 20 LEU n 1 21 GLN n 1 22 SER n 1 23 SER n 1 24 TRP n 1 25 ASP n 1 26 MET n 1 27 MET n 1 28 GLY n 1 29 MET n 1 30 LEU n 1 31 ALA n 1 32 SER n 1 33 GLN n 1 34 GLN n 1 35 ASN n 1 36 GLN n 1 37 SER n 1 38 GLY n 1 39 PRO n 1 40 SER n 1 41 GLY n 1 42 ASN n 1 43 ASN n 1 44 GLN n 1 45 ASN n 1 46 GLN n 1 47 GLY n 1 48 ASN n 1 49 MET n 1 50 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TARDBP, TDP43' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pHGB _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 311 311 MET MET A . n A 1 2 ASN 2 312 312 ASN ASN A . n A 1 3 PHE 3 313 313 PHE PHE A . n A 1 4 GLY 4 314 314 GLY GLY A . n A 1 5 ALA 5 315 315 ALA ALA A . n A 1 6 PHE 6 316 316 PHE PHE A . n A 1 7 SER 7 317 317 SER SER A . n A 1 8 ILE 8 318 318 ILE ILE A . n A 1 9 ASN 9 319 319 ASN ASN A . n A 1 10 PRO 10 320 320 PRO PRO A . n A 1 11 ALA 11 321 321 ALA ALA A . n A 1 12 MET 12 322 322 MET MET A . n A 1 13 MET 13 323 323 MET MET A . n A 1 14 ALA 14 324 324 ALA ALA A . n A 1 15 ALA 15 325 325 ALA ALA A . n A 1 16 ALA 16 326 326 ALA ALA A . n A 1 17 GLN 17 327 327 GLN GLN A . n A 1 18 ALA 18 328 328 ALA ALA A . n A 1 19 ALA 19 329 329 ALA ALA A . n A 1 20 LEU 20 330 330 LEU LEU A . n A 1 21 GLN 21 331 331 GLN GLN A . n A 1 22 SER 22 332 332 SER SER A . n A 1 23 SER 23 333 333 SER SER A . n A 1 24 TRP 24 334 334 TRP TRP A . n A 1 25 ASP 25 335 335 ASP ASP A . n A 1 26 MET 26 336 336 MET MET A . n A 1 27 MET 27 337 337 MET MET A . n A 1 28 GLY 28 338 338 GLY GLY A . n A 1 29 MET 29 339 339 MET MET A . n A 1 30 LEU 30 340 340 LEU LEU A . n A 1 31 ALA 31 341 341 ALA ALA A . n A 1 32 SER 32 342 342 SER SER A . n A 1 33 GLN 33 343 343 GLN GLN A . n A 1 34 GLN 34 344 344 GLN GLN A . n A 1 35 ASN 35 345 345 ASN ASN A . n A 1 36 GLN 36 346 346 GLN GLN A . n A 1 37 SER 37 347 347 SER SER A . n A 1 38 GLY 38 348 348 GLY GLY A . n A 1 39 PRO 39 349 349 PRO PRO A . n A 1 40 SER 40 350 350 SER SER A . n A 1 41 GLY 41 351 351 GLY GLY A . n A 1 42 ASN 42 352 352 ASN ASN A . n A 1 43 ASN 43 353 353 ASN ASN A . n A 1 44 GLN 44 354 354 GLN GLN A . n A 1 45 ASN 45 355 355 ASN ASN A . n A 1 46 GLN 46 356 356 GLN GLN A . n A 1 47 GLY 47 357 357 GLY GLY A . n A 1 48 ASN 48 358 358 ASN ASN A . n A 1 49 MET 49 359 359 MET MET A . n A 1 50 GLN 50 360 360 GLN GLN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N4G _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N4G _struct.title 'Solution Structure of the G335D Mutant of TDP-43 Amyloidogenic Core Region' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N4G _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'TDP-43, Amyloidogenic Core Region, G335D, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TADBP_HUMAN _struct_ref.pdbx_db_accession Q13148 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ _struct_ref.pdbx_align_begin 311 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N4G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13148 _struct_ref_seq.db_align_beg 311 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 360 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 311 _struct_ref_seq.pdbx_auth_seq_align_end 360 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2N4G _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 25 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q13148 _struct_ref_seq_dif.db_mon_id GLY _struct_ref_seq_dif.pdbx_seq_db_seq_num 335 _struct_ref_seq_dif.details 'SEE REMARK 999' _struct_ref_seq_dif.pdbx_auth_seq_num 335 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 10 ? GLN A 21 ? PRO A 320 GLN A 331 1 ? 12 HELX_P HELX_P2 2 MET A 29 ? GLN A 34 ? MET A 339 GLN A 344 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 317 ? ? 69.39 -59.28 2 1 GLN A 331 ? ? 70.24 -71.59 3 1 ASP A 335 ? ? -143.04 -45.51 4 1 MET A 336 ? ? -142.92 -25.66 5 1 GLN A 354 ? ? -90.13 54.99 6 1 ASN A 358 ? ? -153.57 8.57 7 2 PHE A 316 ? ? -66.68 98.94 8 2 SER A 317 ? ? -83.16 46.61 9 2 GLN A 331 ? ? -163.63 -62.90 10 2 MET A 336 ? ? -133.23 -83.82 11 3 PHE A 316 ? ? 60.77 -174.98 12 3 ASP A 335 ? ? -149.48 -35.27 13 3 GLN A 356 ? ? 58.30 90.03 14 4 PHE A 316 ? ? -141.38 -53.56 15 4 MET A 336 ? ? -146.19 -45.33 16 4 ASN A 345 ? ? -98.01 52.57 17 4 GLN A 346 ? ? 176.04 146.79 18 4 GLN A 354 ? ? 68.51 -46.60 19 4 GLN A 356 ? ? 70.25 -82.36 20 5 PHE A 316 ? ? 65.77 70.40 21 5 MET A 336 ? ? -93.67 -80.60 22 5 SER A 347 ? ? -101.67 -60.75 23 5 SER A 350 ? ? 71.77 -179.71 24 5 ASN A 352 ? ? 61.34 87.25 25 6 GLN A 331 ? ? 51.16 88.55 26 6 MET A 336 ? ? -175.51 -17.45 27 6 GLN A 346 ? ? 69.26 -63.89 28 6 SER A 347 ? ? 54.87 70.68 29 6 MET A 359 ? ? 69.00 -68.54 30 7 GLN A 331 ? ? -107.94 -155.82 31 7 SER A 332 ? ? 74.81 -53.83 32 7 ASP A 335 ? ? 169.38 -41.39 33 7 GLN A 354 ? ? -90.64 44.02 34 7 ASN A 355 ? ? -70.31 -71.89 35 7 GLN A 356 ? ? -162.45 118.49 36 8 ASN A 312 ? ? -80.70 -74.22 37 8 ASP A 335 ? ? -148.18 -12.76 38 8 MET A 336 ? ? -156.93 -31.27 39 8 SER A 350 ? ? 75.81 -52.18 40 8 GLN A 354 ? ? 64.07 172.97 41 9 ILE A 318 ? ? 71.22 -50.20 42 9 ASP A 335 ? ? -147.39 -23.32 43 9 SER A 350 ? ? -146.54 41.08 44 9 GLN A 354 ? ? 64.91 -149.04 45 9 GLN A 356 ? ? -118.44 -165.78 46 10 PHE A 316 ? ? -90.37 45.66 47 10 ASP A 335 ? ? 178.75 49.59 48 10 SER A 347 ? ? -107.85 63.87 49 10 ASN A 352 ? ? -117.82 74.77 50 10 GLN A 354 ? ? -151.90 74.53 # _pdbx_entry_details.entry_id 2N4G _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'G335D IS NATURAL VARIENT ACCORDING TO DATABASE Q13148 (TADBP_HUMAN).' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N4G _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N4G _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents ;600 uM [U-99% 13C; U-99% 15N] GB1-TDP(311-360)-G335D-1, 20 mM sodium phosphate-2, 50 mM sodium chloride-3, 8 % [U-99% 2H] D2O-4, 0.02 w/v sodium azide-5, 92 % H2O-6, 93% H2O/7% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'GB1-TDP(311-360)-G335D-1' 600 ? uM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 D2O-4 8 ? % '[U-99% 2H]' 1 'sodium azide-5' 0.02 ? w/v ? 1 H2O-6 92 ? % ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 80 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCACB' 1 4 1 '3D HNHA' 1 5 1 '3D C(CO)NH' 1 6 1 '3D 1H-13C NOESY aliphatic' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D HNCO' 1 9 1 '3D HCCH-TOCSY' # _pdbx_nmr_refine.entry_id 2N4G _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 1 ? Goddard 'data analysis' Sparky 2 ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 3 ? ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 4 ? 'Koradi, Billeter and Wuthrich' 'structure solution' MOLMOL 5 ? ;Linge, O'Donoghue and Nilges ; refinement ARIA 6 ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLY N N N N 67 GLY CA C N N 68 GLY C C N N 69 GLY O O N N 70 GLY OXT O N N 71 GLY H H N N 72 GLY H2 H N N 73 GLY HA2 H N N 74 GLY HA3 H N N 75 GLY HXT H N N 76 ILE N N N N 77 ILE CA C N S 78 ILE C C N N 79 ILE O O N N 80 ILE CB C N S 81 ILE CG1 C N N 82 ILE CG2 C N N 83 ILE CD1 C N N 84 ILE OXT O N N 85 ILE H H N N 86 ILE H2 H N N 87 ILE HA H N N 88 ILE HB H N N 89 ILE HG12 H N N 90 ILE HG13 H N N 91 ILE HG21 H N N 92 ILE HG22 H N N 93 ILE HG23 H N N 94 ILE HD11 H N N 95 ILE HD12 H N N 96 ILE HD13 H N N 97 ILE HXT H N N 98 LEU N N N N 99 LEU CA C N S 100 LEU C C N N 101 LEU O O N N 102 LEU CB C N N 103 LEU CG C N N 104 LEU CD1 C N N 105 LEU CD2 C N N 106 LEU OXT O N N 107 LEU H H N N 108 LEU H2 H N N 109 LEU HA H N N 110 LEU HB2 H N N 111 LEU HB3 H N N 112 LEU HG H N N 113 LEU HD11 H N N 114 LEU HD12 H N N 115 LEU HD13 H N N 116 LEU HD21 H N N 117 LEU HD22 H N N 118 LEU HD23 H N N 119 LEU HXT H N N 120 MET N N N N 121 MET CA C N S 122 MET C C N N 123 MET O O N N 124 MET CB C N N 125 MET CG C N N 126 MET SD S N N 127 MET CE C N N 128 MET OXT O N N 129 MET H H N N 130 MET H2 H N N 131 MET HA H N N 132 MET HB2 H N N 133 MET HB3 H N N 134 MET HG2 H N N 135 MET HG3 H N N 136 MET HE1 H N N 137 MET HE2 H N N 138 MET HE3 H N N 139 MET HXT H N N 140 PHE N N N N 141 PHE CA C N S 142 PHE C C N N 143 PHE O O N N 144 PHE CB C N N 145 PHE CG C Y N 146 PHE CD1 C Y N 147 PHE CD2 C Y N 148 PHE CE1 C Y N 149 PHE CE2 C Y N 150 PHE CZ C Y N 151 PHE OXT O N N 152 PHE H H N N 153 PHE H2 H N N 154 PHE HA H N N 155 PHE HB2 H N N 156 PHE HB3 H N N 157 PHE HD1 H N N 158 PHE HD2 H N N 159 PHE HE1 H N N 160 PHE HE2 H N N 161 PHE HZ H N N 162 PHE HXT H N N 163 PRO N N N N 164 PRO CA C N S 165 PRO C C N N 166 PRO O O N N 167 PRO CB C N N 168 PRO CG C N N 169 PRO CD C N N 170 PRO OXT O N N 171 PRO H H N N 172 PRO HA H N N 173 PRO HB2 H N N 174 PRO HB3 H N N 175 PRO HG2 H N N 176 PRO HG3 H N N 177 PRO HD2 H N N 178 PRO HD3 H N N 179 PRO HXT H N N 180 SER N N N N 181 SER CA C N S 182 SER C C N N 183 SER O O N N 184 SER CB C N N 185 SER OG O N N 186 SER OXT O N N 187 SER H H N N 188 SER H2 H N N 189 SER HA H N N 190 SER HB2 H N N 191 SER HB3 H N N 192 SER HG H N N 193 SER HXT H N N 194 TRP N N N N 195 TRP CA C N S 196 TRP C C N N 197 TRP O O N N 198 TRP CB C N N 199 TRP CG C Y N 200 TRP CD1 C Y N 201 TRP CD2 C Y N 202 TRP NE1 N Y N 203 TRP CE2 C Y N 204 TRP CE3 C Y N 205 TRP CZ2 C Y N 206 TRP CZ3 C Y N 207 TRP CH2 C Y N 208 TRP OXT O N N 209 TRP H H N N 210 TRP H2 H N N 211 TRP HA H N N 212 TRP HB2 H N N 213 TRP HB3 H N N 214 TRP HD1 H N N 215 TRP HE1 H N N 216 TRP HE3 H N N 217 TRP HZ2 H N N 218 TRP HZ3 H N N 219 TRP HH2 H N N 220 TRP HXT H N N 221 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLY N CA sing N N 63 GLY N H sing N N 64 GLY N H2 sing N N 65 GLY CA C sing N N 66 GLY CA HA2 sing N N 67 GLY CA HA3 sing N N 68 GLY C O doub N N 69 GLY C OXT sing N N 70 GLY OXT HXT sing N N 71 ILE N CA sing N N 72 ILE N H sing N N 73 ILE N H2 sing N N 74 ILE CA C sing N N 75 ILE CA CB sing N N 76 ILE CA HA sing N N 77 ILE C O doub N N 78 ILE C OXT sing N N 79 ILE CB CG1 sing N N 80 ILE CB CG2 sing N N 81 ILE CB HB sing N N 82 ILE CG1 CD1 sing N N 83 ILE CG1 HG12 sing N N 84 ILE CG1 HG13 sing N N 85 ILE CG2 HG21 sing N N 86 ILE CG2 HG22 sing N N 87 ILE CG2 HG23 sing N N 88 ILE CD1 HD11 sing N N 89 ILE CD1 HD12 sing N N 90 ILE CD1 HD13 sing N N 91 ILE OXT HXT sing N N 92 LEU N CA sing N N 93 LEU N H sing N N 94 LEU N H2 sing N N 95 LEU CA C sing N N 96 LEU CA CB sing N N 97 LEU CA HA sing N N 98 LEU C O doub N N 99 LEU C OXT sing N N 100 LEU CB CG sing N N 101 LEU CB HB2 sing N N 102 LEU CB HB3 sing N N 103 LEU CG CD1 sing N N 104 LEU CG CD2 sing N N 105 LEU CG HG sing N N 106 LEU CD1 HD11 sing N N 107 LEU CD1 HD12 sing N N 108 LEU CD1 HD13 sing N N 109 LEU CD2 HD21 sing N N 110 LEU CD2 HD22 sing N N 111 LEU CD2 HD23 sing N N 112 LEU OXT HXT sing N N 113 MET N CA sing N N 114 MET N H sing N N 115 MET N H2 sing N N 116 MET CA C sing N N 117 MET CA CB sing N N 118 MET CA HA sing N N 119 MET C O doub N N 120 MET C OXT sing N N 121 MET CB CG sing N N 122 MET CB HB2 sing N N 123 MET CB HB3 sing N N 124 MET CG SD sing N N 125 MET CG HG2 sing N N 126 MET CG HG3 sing N N 127 MET SD CE sing N N 128 MET CE HE1 sing N N 129 MET CE HE2 sing N N 130 MET CE HE3 sing N N 131 MET OXT HXT sing N N 132 PHE N CA sing N N 133 PHE N H sing N N 134 PHE N H2 sing N N 135 PHE CA C sing N N 136 PHE CA CB sing N N 137 PHE CA HA sing N N 138 PHE C O doub N N 139 PHE C OXT sing N N 140 PHE CB CG sing N N 141 PHE CB HB2 sing N N 142 PHE CB HB3 sing N N 143 PHE CG CD1 doub Y N 144 PHE CG CD2 sing Y N 145 PHE CD1 CE1 sing Y N 146 PHE CD1 HD1 sing N N 147 PHE CD2 CE2 doub Y N 148 PHE CD2 HD2 sing N N 149 PHE CE1 CZ doub Y N 150 PHE CE1 HE1 sing N N 151 PHE CE2 CZ sing Y N 152 PHE CE2 HE2 sing N N 153 PHE CZ HZ sing N N 154 PHE OXT HXT sing N N 155 PRO N CA sing N N 156 PRO N CD sing N N 157 PRO N H sing N N 158 PRO CA C sing N N 159 PRO CA CB sing N N 160 PRO CA HA sing N N 161 PRO C O doub N N 162 PRO C OXT sing N N 163 PRO CB CG sing N N 164 PRO CB HB2 sing N N 165 PRO CB HB3 sing N N 166 PRO CG CD sing N N 167 PRO CG HG2 sing N N 168 PRO CG HG3 sing N N 169 PRO CD HD2 sing N N 170 PRO CD HD3 sing N N 171 PRO OXT HXT sing N N 172 SER N CA sing N N 173 SER N H sing N N 174 SER N H2 sing N N 175 SER CA C sing N N 176 SER CA CB sing N N 177 SER CA HA sing N N 178 SER C O doub N N 179 SER C OXT sing N N 180 SER CB OG sing N N 181 SER CB HB2 sing N N 182 SER CB HB3 sing N N 183 SER OG HG sing N N 184 SER OXT HXT sing N N 185 TRP N CA sing N N 186 TRP N H sing N N 187 TRP N H2 sing N N 188 TRP CA C sing N N 189 TRP CA CB sing N N 190 TRP CA HA sing N N 191 TRP C O doub N N 192 TRP C OXT sing N N 193 TRP CB CG sing N N 194 TRP CB HB2 sing N N 195 TRP CB HB3 sing N N 196 TRP CG CD1 doub Y N 197 TRP CG CD2 sing Y N 198 TRP CD1 NE1 sing Y N 199 TRP CD1 HD1 sing N N 200 TRP CD2 CE2 doub Y N 201 TRP CD2 CE3 sing Y N 202 TRP NE1 CE2 sing Y N 203 TRP NE1 HE1 sing N N 204 TRP CE2 CZ2 sing Y N 205 TRP CE3 CZ3 doub Y N 206 TRP CE3 HE3 sing N N 207 TRP CZ2 CH2 doub Y N 208 TRP CZ2 HZ2 sing N N 209 TRP CZ3 CH2 sing Y N 210 TRP CZ3 HZ3 sing N N 211 TRP CH2 HH2 sing N N 212 TRP OXT HXT sing N N 213 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2N4G _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #