data_2N50 # _entry.id 2N50 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104429 RCSB ? ? 2N50 PDB pdb_00002n50 10.2210/pdb2n50/pdb 25688 BMRB ? ? D_1000104429 WWPDB ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25688 BMRB 'associated NMR restraints' . 2N4Z PDB unspecified . 25688 BMRB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N50 _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2015-07-02 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Park, Y.' 1 'Jung, M.' 2 'Song, H.' 3 'Jeong, K.' 4 'Kim, Y.' 5 # _citation.id primary _citation.title 'Novel Structural Components Contribute to the High Thermal Stability of Acyl Carrier Protein from Enterococcus faecalis.' _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_volume 291 _citation.page_first 1692 _citation.page_last 1702 _citation.year 2016 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 1083-351X _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26631734 _citation.pdbx_database_id_DOI 10.1074/jbc.M115.674408 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Park, Y.G.' 1 ? primary 'Jung, M.C.' 2 ? primary 'Song, H.' 3 ? primary 'Jeong, K.W.' 4 ? primary 'Bang, E.' 5 ? primary 'Hwang, G.S.' 6 ? primary 'Kim, Y.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Acyl carrier protein' _entity.formula_weight 8840.639 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MTREEVLQKVAKIISNHFDIEADQVTDQLNIKDDLNADSISVMEFVLELEDEFGTEISDEDAEKIETVGAAVDYIVSNS _entity_poly.pdbx_seq_one_letter_code_can MTREEVLQKVAKIISNHFDIEADQVTDQLNIKDDLNADSISVMEFVLELEDEFGTEISDEDAEKIETVGAAVDYIVSNS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ARG n 1 4 GLU n 1 5 GLU n 1 6 VAL n 1 7 LEU n 1 8 GLN n 1 9 LYS n 1 10 VAL n 1 11 ALA n 1 12 LYS n 1 13 ILE n 1 14 ILE n 1 15 SER n 1 16 ASN n 1 17 HIS n 1 18 PHE n 1 19 ASP n 1 20 ILE n 1 21 GLU n 1 22 ALA n 1 23 ASP n 1 24 GLN n 1 25 VAL n 1 26 THR n 1 27 ASP n 1 28 GLN n 1 29 LEU n 1 30 ASN n 1 31 ILE n 1 32 LYS n 1 33 ASP n 1 34 ASP n 1 35 LEU n 1 36 ASN n 1 37 ALA n 1 38 ASP n 1 39 SER n 1 40 ILE n 1 41 SER n 1 42 VAL n 1 43 MET n 1 44 GLU n 1 45 PHE n 1 46 VAL n 1 47 LEU n 1 48 GLU n 1 49 LEU n 1 50 GLU n 1 51 ASP n 1 52 GLU n 1 53 PHE n 1 54 GLY n 1 55 THR n 1 56 GLU n 1 57 ILE n 1 58 SER n 1 59 ASP n 1 60 GLU n 1 61 ASP n 1 62 ALA n 1 63 GLU n 1 64 LYS n 1 65 ILE n 1 66 GLU n 1 67 THR n 1 68 VAL n 1 69 GLY n 1 70 ALA n 1 71 ALA n 1 72 VAL n 1 73 ASP n 1 74 TYR n 1 75 ILE n 1 76 VAL n 1 77 SER n 1 78 ASN n 1 79 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'acpP, EF_3111' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700802 / V583' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterococcus faecalis V583' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 226185 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET-11a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q82ZE9_ENTFA _struct_ref.pdbx_db_accession Q82ZE9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MTREEVLQKVAKIISNHFDIEADQVTDQLNIKDDLNADSISVMEFVLELEDEFGTEISDEDAEKIETVGAAVDYIVSNS _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N50 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q82ZE9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 79 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 79 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCACB' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.1 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '25 mM MES-1, 5 mM Cacl2-2, 5 mM DTT-3, 10 % [U-99% 2H] D2O-4, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2N50 _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N50 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 4.38 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 4.04 _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N50 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 1 ? 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N50 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N50 _struct.title 'Novel Structural Components Contribute to the High Thermal Stability of Acyl Carrier Protein from Enterococcus faecalis' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N50 _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' _struct_keywords.text 'Acyl carrier protein, Enterococcus faecalis, Fatty acid synthase, BIOSYNTHETIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 2 ? PHE A 18 ? THR A 2 PHE A 18 1 ? 17 HELX_P HELX_P2 2 ASN A 30 ? LEU A 35 ? ASN A 30 LEU A 35 1 ? 6 HELX_P HELX_P3 3 SER A 39 ? PHE A 53 ? SER A 39 PHE A 53 1 ? 15 HELX_P HELX_P4 4 GLU A 60 ? LYS A 64 ? GLU A 60 LYS A 64 5 ? 5 HELX_P HELX_P5 5 THR A 67 ? SER A 79 ? THR A 67 SER A 79 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2N50 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 SER 79 79 79 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-09 2 'Structure model' 1 1 2017-06-07 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.18 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.02 _pdbx_nmr_ensemble_rms.entry_id 2N50 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id MES-1 25 ? mM ? 1 Cacl2-2 5 ? mM ? 1 DTT-3 5 ? mM ? 1 D2O-4 10 ? % '[U-99% 2H]' 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 25 ? ? -46.23 105.43 2 2 VAL A 25 ? ? -45.92 107.57 3 2 ILE A 65 ? ? -147.45 36.19 4 3 VAL A 25 ? ? -46.52 105.70 5 3 ILE A 65 ? ? -147.33 35.12 6 4 VAL A 25 ? ? -45.71 109.66 7 5 VAL A 25 ? ? -47.89 104.91 8 5 ASP A 38 ? ? -61.10 -179.54 9 5 SER A 58 ? ? -54.86 170.80 10 6 VAL A 25 ? ? -46.97 105.33 11 7 VAL A 25 ? ? -47.47 105.01 12 7 ILE A 65 ? ? -147.88 36.10 13 8 ILE A 65 ? ? -146.85 34.65 14 9 VAL A 25 ? ? -46.57 105.34 15 9 SER A 58 ? ? -54.76 170.44 16 10 ILE A 65 ? ? -147.47 35.25 17 11 VAL A 25 ? ? -46.89 105.54 18 11 ASP A 38 ? ? -57.22 179.40 19 12 VAL A 25 ? ? -47.31 105.25 20 13 VAL A 25 ? ? -46.93 105.17 21 14 VAL A 25 ? ? -47.74 104.68 22 14 ILE A 65 ? ? -149.00 38.22 23 15 VAL A 25 ? ? -47.03 105.16 24 15 SER A 58 ? ? -55.02 172.67 25 15 ILE A 65 ? ? -69.19 77.54 26 16 ILE A 65 ? ? -147.83 36.18 27 17 VAL A 25 ? ? -44.33 106.50 28 17 LYS A 64 ? ? -98.83 34.82 29 17 ILE A 65 ? ? -147.73 33.24 30 18 VAL A 25 ? ? -45.08 105.97 31 18 ASP A 38 ? ? -59.99 171.50 32 18 LYS A 64 ? ? -99.05 34.54 33 18 ILE A 65 ? ? -148.92 35.43 34 20 VAL A 25 ? ? -47.32 104.92 35 20 ILE A 65 ? ? -147.42 34.60 #