data_2N5G # _entry.id 2N5G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104445 RCSB ? ? 2N5G PDB pdb_00002n5g 10.2210/pdb2n5g/pdb 6999 BMRB ? ? D_1000104445 WWPDB ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5CKT PDB 'Crystal structure of KorA in absence of DNA' unspecified 5CM3 PDB 'Crystal structure of KorA in complex with its operator DNA' unspecified 5CLV PDB 'Crystal structure of KorA in complex with its operator DNA' unspecified 6999 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N5G _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-07-17 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rajasekar, K.V.' 1 'Lovering, A.L.' 2 'Dancea, F.V.' 3 'Scott, D.J.' 4 'Harris, S.' 5 'Bingle, L.E.' 6 'Roessle, M.' 7 'Thomas, C.M.' 8 'Hyde, E.I.' 9 'White, S.A.' 10 # _citation.id primary _citation.title 'Flexibility of KorA, a plasmid-encoded, global transcription regulator, in the presence and the absence of its operator.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 44 _citation.page_first 4947 _citation.page_last 4956 _citation.year 2016 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27016739 _citation.pdbx_database_id_DOI 10.1093/nar/gkw191 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rajasekar, K.V.' 1 ? primary 'Lovering, A.L.' 2 ? primary 'Dancea, F.' 3 ? primary 'Scott, D.J.' 4 ? primary 'Harris, S.A.' 5 ? primary 'Bingle, L.E.' 6 ? primary 'Roessle, M.' 7 ? primary 'Thomas, C.M.' 8 ? primary 'Hyde, E.I.' 9 ? primary 'White, S.A.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TrfB transcriptional repressor protein' _entity.formula_weight 11323.908 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Regulatory protein KorA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPE HQAYIVRKWEADAKKKQETKR ; _entity_poly.pdbx_seq_one_letter_code_can ;MKKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPE HQAYIVRKWEADAKKKQETKR ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LYS n 1 4 ARG n 1 5 LEU n 1 6 THR n 1 7 GLU n 1 8 SER n 1 9 GLN n 1 10 PHE n 1 11 GLN n 1 12 GLU n 1 13 ALA n 1 14 ILE n 1 15 GLN n 1 16 GLY n 1 17 LEU n 1 18 GLU n 1 19 VAL n 1 20 GLY n 1 21 GLN n 1 22 GLN n 1 23 THR n 1 24 ILE n 1 25 GLU n 1 26 ILE n 1 27 ALA n 1 28 ARG n 1 29 GLY n 1 30 VAL n 1 31 LEU n 1 32 VAL n 1 33 ASP n 1 34 GLY n 1 35 LYS n 1 36 PRO n 1 37 GLN n 1 38 ALA n 1 39 THR n 1 40 PHE n 1 41 ALA n 1 42 THR n 1 43 SER n 1 44 LEU n 1 45 GLY n 1 46 LEU n 1 47 THR n 1 48 ARG n 1 49 GLY n 1 50 ALA n 1 51 VAL n 1 52 SER n 1 53 GLN n 1 54 ALA n 1 55 VAL n 1 56 HIS n 1 57 ARG n 1 58 VAL n 1 59 TRP n 1 60 ALA n 1 61 ALA n 1 62 PHE n 1 63 GLU n 1 64 ASP n 1 65 LYS n 1 66 ASN n 1 67 LEU n 1 68 PRO n 1 69 GLU n 1 70 GLY n 1 71 TYR n 1 72 ALA n 1 73 ARG n 1 74 VAL n 1 75 THR n 1 76 ALA n 1 77 VAL n 1 78 LEU n 1 79 PRO n 1 80 GLU n 1 81 HIS n 1 82 GLN n 1 83 ALA n 1 84 TYR n 1 85 ILE n 1 86 VAL n 1 87 ARG n 1 88 LYS n 1 89 TRP n 1 90 GLU n 1 91 ALA n 1 92 ASP n 1 93 ALA n 1 94 LYS n 1 95 LYS n 1 96 LYS n 1 97 GLN n 1 98 GLU n 1 99 THR n 1 100 LYS n 1 101 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'trfB, korA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET28a derivative pGBT340' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KORA2_ECOLX _struct_ref.pdbx_db_accession P03052 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPE HQAYIVRKWEADAKKKQETKR ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2N5G A 1 ? 101 ? P03052 1 ? 101 ? 1 101 2 1 2N5G B 1 ? 101 ? P03052 1 ? 101 ? 1 101 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 HNCA 1 2 1 'HN(CO)CA' 1 3 1 HNCO 1 4 1 'HN(CA)CO' 1 5 1 'CBCA(CO)NH' 1 6 1 HNCACB 1 7 1 'HB(CB)HA(CA)CONH' 1 8 1 'HB(CB)HA(CA)NH' 1 9 1 'HC(C)H-TOCSY' 1 10 1 'TOCSY-15N HSQC' 1 11 1 '(H)CC(CO)NH-TOCSY' 1 12 1 'H(CC)(CO)NH-TOCSY' 1 13 1 '2D 1H-1H TOCSY' 1 14 1 '(HB) CB (CG CD) HD' 1 15 1 '(HB) CB (CG CD CE) HE' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.2 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-13C; U-15N] KorA, 25 mM Phosphate Buffer, 0.1 mM EDTA, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 600 Varian UNITYPLUS 2 'Varian Unity Plus' # _pdbx_nmr_refine.entry_id 2N5G _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N5G _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N5G _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal CCPN 'chemical shift assignment' CCPN 1.0.8 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'structure solution' NMRPipe ? 3 ;Linge, O'Donoghue and Nilges ; processing NMRPipe ? 4 ;Linge, O'Donoghue and Nilges ; 'structure solution' NMRPipe ? 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 6 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'structure solution' NMRPipe ? 7 ;Linge, O'Donoghue and Nilges ; processing NMRPipe ? 8 ;Linge, O'Donoghue and Nilges ; 'structure solution' NMRPipe ? 9 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 10 ;Linge, O'Donoghue and Nilges ; refinement ARIA ? 11 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'KorA Repressor Protein' _exptl.entry_id 2N5G _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N5G _struct.title 'NMR structure of KorA, a plasmid-encoded, global transcription regulator KorA' _struct.pdbx_model_details 'lowest energy, model167' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N5G _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 6 ? GLN A 15 ? THR A 6 GLN A 15 1 ? 10 HELX_P HELX_P2 2 GLY A 20 ? LEU A 31 ? GLY A 20 LEU A 31 1 ? 12 HELX_P HELX_P3 3 PRO A 36 ? GLY A 45 ? PRO A 36 GLY A 45 1 ? 10 HELX_P HELX_P4 4 THR A 47 ? ASN A 66 ? THR A 47 ASN A 66 1 ? 20 HELX_P HELX_P5 5 PRO A 79 ? GLU A 98 ? PRO A 79 GLU A 98 1 ? 20 HELX_P HELX_P6 6 THR B 6 ? GLN B 15 ? THR B 6 GLN B 15 1 ? 10 HELX_P HELX_P7 7 GLY B 20 ? LEU B 31 ? GLY B 20 LEU B 31 1 ? 12 HELX_P HELX_P8 8 PRO B 36 ? GLY B 45 ? PRO B 36 GLY B 45 1 ? 10 HELX_P HELX_P9 9 THR B 47 ? ASP B 64 ? THR B 47 ASP B 64 1 ? 18 HELX_P HELX_P10 10 PRO B 79 ? GLU B 98 ? PRO B 79 GLU B 98 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 73 ? VAL A 77 ? ARG A 73 VAL A 77 A 2 ARG B 73 ? VAL B 77 ? ARG B 73 VAL B 77 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ALA _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 76 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 76 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id B _pdbx_struct_sheet_hbond.range_2_label_seq_id 74 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id B _pdbx_struct_sheet_hbond.range_2_auth_seq_id 74 # _atom_sites.entry_id 2N5G _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ARG 101 101 101 ARG ARG A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 LYS 2 2 2 LYS LYS B . n B 1 3 LYS 3 3 3 LYS LYS B . n B 1 4 ARG 4 4 4 ARG ARG B . n B 1 5 LEU 5 5 5 LEU LEU B . n B 1 6 THR 6 6 6 THR THR B . n B 1 7 GLU 7 7 7 GLU GLU B . n B 1 8 SER 8 8 8 SER SER B . n B 1 9 GLN 9 9 9 GLN GLN B . n B 1 10 PHE 10 10 10 PHE PHE B . n B 1 11 GLN 11 11 11 GLN GLN B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 ALA 13 13 13 ALA ALA B . n B 1 14 ILE 14 14 14 ILE ILE B . n B 1 15 GLN 15 15 15 GLN GLN B . n B 1 16 GLY 16 16 16 GLY GLY B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 GLU 18 18 18 GLU GLU B . n B 1 19 VAL 19 19 19 VAL VAL B . n B 1 20 GLY 20 20 20 GLY GLY B . n B 1 21 GLN 21 21 21 GLN GLN B . n B 1 22 GLN 22 22 22 GLN GLN B . n B 1 23 THR 23 23 23 THR THR B . n B 1 24 ILE 24 24 24 ILE ILE B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 ILE 26 26 26 ILE ILE B . n B 1 27 ALA 27 27 27 ALA ALA B . n B 1 28 ARG 28 28 28 ARG ARG B . n B 1 29 GLY 29 29 29 GLY GLY B . n B 1 30 VAL 30 30 30 VAL VAL B . n B 1 31 LEU 31 31 31 LEU LEU B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 ASP 33 33 33 ASP ASP B . n B 1 34 GLY 34 34 34 GLY GLY B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 PRO 36 36 36 PRO PRO B . n B 1 37 GLN 37 37 37 GLN GLN B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 THR 39 39 39 THR THR B . n B 1 40 PHE 40 40 40 PHE PHE B . n B 1 41 ALA 41 41 41 ALA ALA B . n B 1 42 THR 42 42 42 THR THR B . n B 1 43 SER 43 43 43 SER SER B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 GLY 45 45 45 GLY GLY B . n B 1 46 LEU 46 46 46 LEU LEU B . n B 1 47 THR 47 47 47 THR THR B . n B 1 48 ARG 48 48 48 ARG ARG B . n B 1 49 GLY 49 49 49 GLY GLY B . n B 1 50 ALA 50 50 50 ALA ALA B . n B 1 51 VAL 51 51 51 VAL VAL B . n B 1 52 SER 52 52 52 SER SER B . n B 1 53 GLN 53 53 53 GLN GLN B . n B 1 54 ALA 54 54 54 ALA ALA B . n B 1 55 VAL 55 55 55 VAL VAL B . n B 1 56 HIS 56 56 56 HIS HIS B . n B 1 57 ARG 57 57 57 ARG ARG B . n B 1 58 VAL 58 58 58 VAL VAL B . n B 1 59 TRP 59 59 59 TRP TRP B . n B 1 60 ALA 60 60 60 ALA ALA B . n B 1 61 ALA 61 61 61 ALA ALA B . n B 1 62 PHE 62 62 62 PHE PHE B . n B 1 63 GLU 63 63 63 GLU GLU B . n B 1 64 ASP 64 64 64 ASP ASP B . n B 1 65 LYS 65 65 65 LYS LYS B . n B 1 66 ASN 66 66 66 ASN ASN B . n B 1 67 LEU 67 67 67 LEU LEU B . n B 1 68 PRO 68 68 68 PRO PRO B . n B 1 69 GLU 69 69 69 GLU GLU B . n B 1 70 GLY 70 70 70 GLY GLY B . n B 1 71 TYR 71 71 71 TYR TYR B . n B 1 72 ALA 72 72 72 ALA ALA B . n B 1 73 ARG 73 73 73 ARG ARG B . n B 1 74 VAL 74 74 74 VAL VAL B . n B 1 75 THR 75 75 75 THR THR B . n B 1 76 ALA 76 76 76 ALA ALA B . n B 1 77 VAL 77 77 77 VAL VAL B . n B 1 78 LEU 78 78 78 LEU LEU B . n B 1 79 PRO 79 79 79 PRO PRO B . n B 1 80 GLU 80 80 80 GLU GLU B . n B 1 81 HIS 81 81 81 HIS HIS B . n B 1 82 GLN 82 82 82 GLN GLN B . n B 1 83 ALA 83 83 83 ALA ALA B . n B 1 84 TYR 84 84 84 TYR TYR B . n B 1 85 ILE 85 85 85 ILE ILE B . n B 1 86 VAL 86 86 86 VAL VAL B . n B 1 87 ARG 87 87 87 ARG ARG B . n B 1 88 LYS 88 88 88 LYS LYS B . n B 1 89 TRP 89 89 89 TRP TRP B . n B 1 90 GLU 90 90 90 GLU GLU B . n B 1 91 ALA 91 91 91 ALA ALA B . n B 1 92 ASP 92 92 92 ASP ASP B . n B 1 93 ALA 93 93 93 ALA ALA B . n B 1 94 LYS 94 94 94 LYS LYS B . n B 1 95 LYS 95 95 95 LYS LYS B . n B 1 96 LYS 96 96 96 LYS LYS B . n B 1 97 GLN 97 97 97 GLN GLN B . n B 1 98 GLU 98 98 98 GLU GLU B . n B 1 99 THR 99 99 99 THR THR B . n B 1 100 LYS 100 100 100 LYS LYS B . n B 1 101 ARG 101 101 101 ARG ARG B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-20 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id KorA-1 1 ? mM '[U-13C; U-15N]' 1 'Phosphate Buffer-2' 25 ? mM ? 1 EDTA-3 0.1 ? mM ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG3 A GLU 90 ? ? H B VAL 77 ? ? 1.32 2 5 OD2 A ASP 33 ? ? HZ1 A LYS 35 ? ? 1.59 3 9 HB2 B LEU 5 ? ? HZ3 B TRP 59 ? ? 1.25 4 9 OD1 A ASP 92 ? ? HZ1 A LYS 96 ? ? 1.59 5 13 OD2 B ASP 92 ? ? HZ3 B LYS 96 ? ? 1.56 6 13 OD1 A ASP 92 ? ? HZ1 A LYS 95 ? ? 1.57 7 15 HB2 A LYS 3 ? ? HH2 A TRP 59 ? ? 1.31 8 19 HG3 A GLU 90 ? ? H B VAL 77 ? ? 1.34 9 19 HB2 B PRO 36 ? ? HG1 B THR 39 ? ? 1.35 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? -107.17 -151.52 2 1 ASN A 66 ? ? -111.55 -73.47 3 1 PRO A 68 ? ? -79.30 -169.71 4 1 ASN B 66 ? ? -132.73 -79.97 5 1 LEU B 67 ? ? -161.44 109.66 6 2 GLN A 15 ? ? 45.56 -90.84 7 2 THR A 99 ? ? -86.59 36.47 8 2 GLN B 15 ? ? 39.90 -92.76 9 3 LEU A 67 ? ? 63.11 85.50 10 3 LEU B 67 ? ? 64.60 96.21 11 4 LYS A 2 ? ? 59.63 -138.03 12 4 LYS B 2 ? ? -171.58 -179.84 13 5 LEU B 67 ? ? 58.95 89.75 14 5 THR B 99 ? ? -90.14 30.24 15 6 LYS A 2 ? ? -154.46 34.73 16 6 GLN A 15 ? ? 36.57 -109.18 17 6 LYS A 100 ? ? 58.30 77.16 18 6 GLN B 15 ? ? 45.25 -104.89 19 6 LYS B 100 ? ? 62.69 88.60 20 7 PRO A 68 ? ? -82.00 -112.60 21 7 LYS B 2 ? ? -78.74 -96.74 22 7 PRO B 68 ? ? -76.85 -76.02 23 8 GLN A 37 ? ? 62.21 -83.70 24 8 THR A 99 ? ? -93.61 54.55 25 9 LEU A 67 ? ? 65.33 96.45 26 9 LYS B 2 ? ? 59.28 -165.51 27 9 LEU B 31 ? ? -92.91 -60.67 28 9 LEU B 67 ? ? 54.77 74.08 29 10 LEU A 67 ? ? 71.28 105.07 30 10 LEU B 67 ? ? 58.74 83.61 31 11 LEU A 31 ? ? -102.82 -61.38 32 11 LEU A 78 ? ? -151.44 88.63 33 11 GLN B 15 ? ? 44.20 -83.36 34 12 LEU A 67 ? ? 67.32 89.07 35 12 LEU B 67 ? ? 59.71 90.74 36 12 LYS B 100 ? ? -77.30 -168.10 37 13 GLN A 15 ? ? 42.47 -88.40 38 13 GLN B 15 ? ? 33.08 -90.41 39 13 LEU B 67 ? ? -117.88 74.76 40 13 PRO B 68 ? ? -93.90 32.41 41 14 LEU A 31 ? ? -94.50 -62.89 42 14 LEU B 31 ? ? -97.22 -60.93 43 15 PRO A 36 ? ? -97.74 57.26 44 15 LEU A 78 ? ? -173.31 131.83 45 15 PRO B 36 ? ? -99.62 53.77 46 16 LYS A 35 ? ? 68.00 70.25 47 16 GLN A 37 ? ? 60.32 -113.02 48 16 LEU A 67 ? ? 68.80 116.36 49 16 THR A 99 ? ? 72.02 -69.98 50 16 LYS B 35 ? ? 69.73 63.37 51 16 GLN B 37 ? ? 68.20 -72.91 52 16 LEU B 67 ? ? 66.81 101.59 53 16 GLU B 98 ? ? -88.71 30.57 54 16 THR B 99 ? ? 71.60 -73.83 55 17 GLN A 15 ? ? 44.46 -106.20 56 17 GLU A 69 ? ? -133.04 -158.97 57 17 GLN B 15 ? ? 39.52 -111.24 58 17 ASN B 66 ? ? -107.09 46.93 59 18 LYS B 2 ? ? 68.86 178.34 60 18 VAL B 19 ? ? -121.03 -163.88 61 19 LEU A 67 ? ? 71.40 99.24 62 19 PRO A 79 ? ? -37.93 133.32 63 19 GLU A 98 ? ? 56.14 91.35 64 19 THR A 99 ? ? -89.81 37.75 65 19 LEU B 67 ? ? 72.28 97.87 66 19 GLU B 98 ? ? 63.68 130.40 67 20 LEU A 67 ? ? 72.41 115.18 68 20 THR A 99 ? ? -108.85 61.84 69 20 LEU B 67 ? ? 69.86 90.68 #