data_2N5H # _entry.id 2N5H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104446 RCSB ? ? 2N5H PDB pdb_00002n5h 10.2210/pdb2n5h/pdb 25716 BMRB ? ? D_1000104446 WWPDB ? ? # _pdbx_database_related.db_id 25716 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N5H _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-07-17 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jaremko, M.J.' 1 'Lee, D.J.' 2 'Burkart, M.D.' 3 # _citation.id primary _citation.title 'Structure and Substrate Sequestration in the Pyoluteorin Type II Peptidyl Carrier Protein PltL.' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 137 _citation.page_first 11546 _citation.page_last 11549 _citation.year 2015 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26340431 _citation.pdbx_database_id_DOI 10.1021/jacs.5b04525 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jaremko, M.J.' 1 ? primary 'Lee, D.J.' 2 ? primary 'Opella, S.J.' 3 ? primary 'Burkart, M.D.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidyl carrier protein PltL' 10312.802 1 ? ? ? ? 2 non-polymer syn "4'-PHOSPHOPANTETHEINE" 358.348 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTV EQLKAESALE ; _entity_poly.pdbx_seq_one_letter_code_can ;MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTV EQLKAESALE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLY n 1 4 GLU n 1 5 GLU n 1 6 VAL n 1 7 LYS n 1 8 GLU n 1 9 LYS n 1 10 ILE n 1 11 ARG n 1 12 ARG n 1 13 TYR n 1 14 ILE n 1 15 MET n 1 16 GLU n 1 17 ASP n 1 18 LEU n 1 19 ILE n 1 20 GLY n 1 21 PRO n 1 22 SER n 1 23 ALA n 1 24 LYS n 1 25 GLU n 1 26 ASP n 1 27 GLU n 1 28 LEU n 1 29 ASP n 1 30 ASP n 1 31 GLN n 1 32 THR n 1 33 PRO n 1 34 LEU n 1 35 LEU n 1 36 GLU n 1 37 TRP n 1 38 GLY n 1 39 ILE n 1 40 LEU n 1 41 ASN n 1 42 SER n 1 43 MET n 1 44 ASN n 1 45 ILE n 1 46 VAL n 1 47 LYS n 1 48 LEU n 1 49 MET n 1 50 VAL n 1 51 TYR n 1 52 ILE n 1 53 ARG n 1 54 ASP n 1 55 GLU n 1 56 MET n 1 57 GLY n 1 58 VAL n 1 59 SER n 1 60 ILE n 1 61 PRO n 1 62 SER n 1 63 THR n 1 64 HIS n 1 65 ILE n 1 66 THR n 1 67 GLY n 1 68 LYS n 1 69 TYR n 1 70 PHE n 1 71 LYS n 1 72 ASP n 1 73 LEU n 1 74 ASN n 1 75 ALA n 1 76 ILE n 1 77 SER n 1 78 ARG n 1 79 THR n 1 80 VAL n 1 81 GLU n 1 82 GLN n 1 83 LEU n 1 84 LYS n 1 85 ALA n 1 86 GLU n 1 87 SER n 1 88 ALA n 1 89 LEU n 1 90 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pltL, PFL_2786' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Pf-5 / ATCC BAA-477' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas protegens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 220664 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pet22b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q4KCZ1_PSEF5 _struct_ref.pdbx_db_accession Q4KCZ1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTV EQLKAECA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N5H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 88 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q4KCZ1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 88 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 88 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N5H SER A 87 ? UNP Q4KCZ1 CYS 87 conflict 87 1 1 2N5H LEU A 89 ? UNP Q4KCZ1 ? ? 'expression tag' 89 2 1 2N5H GLU A 90 ? UNP Q4KCZ1 ? ? 'expression tag' 90 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PNS non-polymer . "4'-PHOSPHOPANTETHEINE" ? 'C11 H23 N2 O7 P S' 358.348 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCACB' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY aliphatic' 1 9 1 '3D 1H-13C NOESY aromatic' 1 10 1 '3D HCCH-COSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298.15 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '50 mM potassium phosphate, 5 mM TCEP, 0.1 % sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Varian 'VS 500' 1 'Varian VS 500' 600 Bruker 'Avance 600' 2 'Bruker Avance 600' 800 Varian 'VS 800' 3 'Varian VS 800' # _pdbx_nmr_refine.entry_id 2N5H _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N5H _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N5H _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N5H _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N5H _struct.title PltL-holo _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N5H _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'peptidyl carrier protein, pyoluteorin, PltL, pyrrole, TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 3 ? ASP A 17 ? GLY A 3 ASP A 17 1 ? 15 HELX_P HELX_P2 2 ASN A 41 ? GLU A 55 ? ASN A 41 GLU A 55 1 ? 15 HELX_P HELX_P3 3 PRO A 61 ? ILE A 65 ? PRO A 61 ILE A 65 5 ? 5 HELX_P HELX_P4 4 ASP A 72 ? GLU A 90 ? ASP A 72 GLU A 90 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 42 _struct_conn.ptnr1_label_atom_id OG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id PNS _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id P24 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 42 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PNS _struct_conn.ptnr2_auth_seq_id 101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.607 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PNS _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE PNS A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER A 42 ? SER A 42 . ? 1_555 ? 2 AC1 6 ILE A 45 ? ILE A 45 . ? 1_555 ? 3 AC1 6 VAL A 46 ? VAL A 46 . ? 1_555 ? 4 AC1 6 ILE A 65 ? ILE A 65 . ? 1_555 ? 5 AC1 6 THR A 66 ? THR A 66 . ? 1_555 ? 6 AC1 6 GLY A 67 ? GLY A 67 . ? 1_555 ? # _atom_sites.entry_id 2N5H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 GLU 90 90 90 GLU GLU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id PNS _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 142 _pdbx_nonpoly_scheme.pdb_mon_id PNS _pdbx_nonpoly_scheme.auth_mon_id PNS _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-16 2 'Structure model' 1 1 2015-09-30 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' struct_conn 4 3 'Structure model' struct_ref_seq_dif 5 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'potassium phosphate-1' 50 ? mM ? 1 TCEP-2 5 ? mM ? 1 'sodium azide-3' 0.1 ? % ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -167.08 -42.62 2 1 ILE A 19 ? ? -83.60 -90.24 3 1 ALA A 23 ? ? -149.34 46.84 4 2 SER A 22 ? ? -89.63 32.18 5 2 ASP A 26 ? ? -152.09 74.50 6 3 ASP A 26 ? ? -141.07 45.65 7 3 PRO A 33 ? ? -67.97 92.05 8 3 ILE A 65 ? ? -69.16 88.25 9 5 SER A 22 ? ? -90.54 31.03 10 6 GLU A 16 ? ? -84.60 -71.00 11 6 ALA A 23 ? ? -119.12 74.90 12 6 GLU A 27 ? ? -139.23 -52.89 13 7 PRO A 33 ? ? -69.86 86.91 14 8 GLU A 16 ? ? -81.54 -70.39 15 8 ILE A 19 ? ? -103.04 -94.20 16 8 ALA A 23 ? ? -153.22 60.49 17 9 ILE A 19 ? ? -96.14 -87.86 18 9 ALA A 23 ? ? -151.30 64.55 19 9 PRO A 33 ? ? -69.32 88.92 20 10 ASP A 17 ? ? -91.59 -62.42 21 10 SER A 22 ? ? -93.67 33.26 22 10 LEU A 40 ? ? -106.88 68.71 23 11 PRO A 33 ? ? -68.92 81.97 24 11 ASP A 54 ? ? -94.13 -60.25 25 12 GLU A 16 ? ? -80.14 -76.41 26 12 ILE A 19 ? ? -87.03 -90.11 27 12 ALA A 23 ? ? -160.51 87.67 28 12 ASP A 26 ? ? -149.60 33.64 29 13 ALA A 23 ? ? -151.08 75.81 30 13 ASP A 26 ? ? -147.19 46.35 31 14 ILE A 65 ? ? -67.36 89.58 32 15 ASP A 2 ? ? -67.09 -76.19 33 15 GLU A 16 ? ? -82.99 -70.44 34 15 ILE A 19 ? ? -102.58 -91.75 35 15 ALA A 23 ? ? -157.56 88.98 36 16 ASP A 2 ? ? -118.28 57.72 37 16 LEU A 18 ? ? -77.59 -71.24 38 16 SER A 22 ? ? -94.81 41.38 39 16 LEU A 40 ? ? -111.31 79.43 40 17 ALA A 23 ? ? -109.70 73.49 41 18 ALA A 23 ? ? -109.09 71.04 42 19 ILE A 19 ? ? -94.29 -88.71 43 19 ALA A 23 ? ? -119.26 79.96 44 19 ASP A 26 ? ? -147.14 36.49 45 20 GLU A 16 ? ? -79.57 -71.64 46 20 ILE A 19 ? ? -89.77 -86.09 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 90 ? O ? A GLU 90 O 2 2 Y 1 A GLU 90 ? O ? A GLU 90 O 3 3 Y 1 A GLU 90 ? O ? A GLU 90 O 4 4 Y 1 A GLU 90 ? O ? A GLU 90 O 5 5 Y 1 A GLU 90 ? O ? A GLU 90 O 6 6 Y 1 A GLU 90 ? O ? A GLU 90 O 7 7 Y 1 A GLU 90 ? O ? A GLU 90 O 8 8 Y 1 A GLU 90 ? O ? A GLU 90 O 9 9 Y 1 A GLU 90 ? O ? A GLU 90 O 10 10 Y 1 A GLU 90 ? O ? A GLU 90 O 11 11 Y 1 A GLU 90 ? O ? A GLU 90 O 12 12 Y 1 A GLU 90 ? O ? A GLU 90 O 13 13 Y 1 A GLU 90 ? O ? A GLU 90 O 14 14 Y 1 A GLU 90 ? O ? A GLU 90 O 15 15 Y 1 A GLU 90 ? O ? A GLU 90 O 16 16 Y 1 A GLU 90 ? O ? A GLU 90 O 17 17 Y 1 A GLU 90 ? O ? A GLU 90 O 18 18 Y 1 A GLU 90 ? O ? A GLU 90 O 19 19 Y 1 A GLU 90 ? O ? A GLU 90 O 20 20 Y 1 A GLU 90 ? O ? A GLU 90 O # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name "4'-PHOSPHOPANTETHEINE" _pdbx_entity_nonpoly.comp_id PNS #