data_2N5Z # _entry.id 2N5Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104464 RCSB ? ? 2N5Z PDB pdb_00002n5z 10.2210/pdb2n5z/pdb 25744 BMRB ? ? D_1000104464 WWPDB ? ? # _pdbx_database_related.db_id 25744 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N5Z _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-08-07 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Maione, V.' 1 'Russo, L.' 2 'Isernia, C.' 3 # _citation.id primary _citation.title 'NMR Structure and Dynamics of the Resuscitation Promoting Factor RpfC Catalytic Domain.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 10 _citation.page_first e0142807 _citation.page_last e0142807 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26576056 _citation.pdbx_database_id_DOI 10.1371/journal.pone.0142807 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Maione, V.' 1 ? primary 'Ruggiero, A.' 2 ? primary 'Russo, L.' 3 ? primary 'De Simone, A.' 4 ? primary 'Pedone, P.V.' 5 ? primary 'Malgieri, G.' 6 ? primary 'Berisio, R.' 7 ? primary 'Isernia, C.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Resuscitation-promoting factor RpfC' _entity.formula_weight 8179.935 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.-.-.- _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMGPSPNWDAVAQCESGGNWAANTGNGKYGGLQFKPATWAAFGGVGNPAAASREQQIAVANRVLAEQGLDAWPTCGAAS GL ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGPSPNWDAVAQCESGGNWAANTGNGKYGGLQFKPATWAAFGGVGNPAAASREQQIAVANRVLAEQGLDAWPTCGAAS GL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 PRO n 1 6 SER n 1 7 PRO n 1 8 ASN n 1 9 TRP n 1 10 ASP n 1 11 ALA n 1 12 VAL n 1 13 ALA n 1 14 GLN n 1 15 CYS n 1 16 GLU n 1 17 SER n 1 18 GLY n 1 19 GLY n 1 20 ASN n 1 21 TRP n 1 22 ALA n 1 23 ALA n 1 24 ASN n 1 25 THR n 1 26 GLY n 1 27 ASN n 1 28 GLY n 1 29 LYS n 1 30 TYR n 1 31 GLY n 1 32 GLY n 1 33 LEU n 1 34 GLN n 1 35 PHE n 1 36 LYS n 1 37 PRO n 1 38 ALA n 1 39 THR n 1 40 TRP n 1 41 ALA n 1 42 ALA n 1 43 PHE n 1 44 GLY n 1 45 GLY n 1 46 VAL n 1 47 GLY n 1 48 ASN n 1 49 PRO n 1 50 ALA n 1 51 ALA n 1 52 ALA n 1 53 SER n 1 54 ARG n 1 55 GLU n 1 56 GLN n 1 57 GLN n 1 58 ILE n 1 59 ALA n 1 60 VAL n 1 61 ALA n 1 62 ASN n 1 63 ARG n 1 64 VAL n 1 65 LEU n 1 66 ALA n 1 67 GLU n 1 68 GLN n 1 69 GLY n 1 70 LEU n 1 71 ASP n 1 72 ALA n 1 73 TRP n 1 74 PRO n 1 75 THR n 1 76 CYS n 1 77 GLY n 1 78 ALA n 1 79 ALA n 1 80 SER n 1 81 GLY n 1 82 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MTCY180.34, rpfC, Rv1884c' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 25618 / H37Rv' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pETM-11 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RPFC_MYCTU _struct_ref.pdbx_db_accession O07747 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GPSPNWDAVAQCESGGNWAANTGNGKYGGLQFKPATWAAFGGVGNPAAASREQQIAVANRVLAEQGLDAWPTCGAASGL _struct_ref.pdbx_align_begin 68 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N5Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O07747 _struct_ref_seq.db_align_beg 68 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N5Z GLY A 1 ? UNP O07747 ? ? 'expression tag' 1 1 1 2N5Z ALA A 2 ? UNP O07747 ? ? 'expression tag' 2 2 1 2N5Z MET A 3 ? UNP O07747 ? ? 'expression tag' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N TOCSY' 1 3 1 '3D 1H-15N NOESY' 1 4 2 '2D 1H-13C HSQC aliphatic' 1 5 2 '2D 1H-13C HSQC aromatic' 1 6 2 '3D CBCA(CO)NH' 1 7 2 '3D HNCACB' 1 8 2 '3D HCCH-TOCSY' 1 9 2 '3D 1H-13C NOESY aliphatic' 1 10 2 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '20 mM [U-100% 15N] sodium phosphate, 150 mM [U-100% 15N] sodium chloride, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '20 mM [U-100% 13C; U-100% 15N] sodium phosphate, 150 mM [U-100% 13C; U-100% 15N] sodium chloride, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2N5Z _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N5Z _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N5Z _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 Varian collection VnmrJ ? 2 Varian processing VnmrJ ? 3 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 4 ? refinement CYANA ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N5Z _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N5Z _struct.title 'Mycobacterium tuberculosis: a dynamic view of the resuscitation promoting factor RpfC catalytic domain' _struct.pdbx_model_details 'closest to the average, model13' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N5Z _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'resuscitation promoting factor, RpfC, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 8 ? SER A 17 ? ASN A 8 SER A 17 1 ? 10 HELX_P HELX_P2 2 LYS A 36 ? ALA A 41 ? LYS A 36 ALA A 41 1 ? 6 HELX_P HELX_P3 3 ALA A 42 ? GLY A 44 ? ALA A 42 GLY A 44 5 ? 3 HELX_P HELX_P4 4 GLY A 47 ? ALA A 52 ? GLY A 47 ALA A 52 1 ? 6 HELX_P HELX_P5 5 SER A 53 ? GLY A 69 ? SER A 53 GLY A 69 1 ? 17 HELX_P HELX_P6 6 LEU A 70 ? TRP A 73 ? LEU A 70 TRP A 73 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 15 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 76 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 15 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 76 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.037 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2N5Z _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LEU 82 82 82 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-11-25 2 'Structure model' 1 1 2015-12-16 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate-1' 20 ? mM '[U-100% 15N]' 1 'sodium chloride-2' 150 ? mM '[U-100% 15N]' 1 'sodium phosphate-3' 20 ? mM '[U-100% 13C; U-100% 15N]' 2 'sodium chloride-4' 150 ? mM '[U-100% 13C; U-100% 15N]' 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2N5Z _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1030 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 539 _pdbx_nmr_constraints.NOE_long_range_total_count 139 _pdbx_nmr_constraints.NOE_medium_range_total_count 132 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 220 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 12 NE A ARG 54 ? ? CZ A ARG 54 ? ? NH1 A ARG 54 ? ? 123.84 120.30 3.54 0.50 N 2 13 NE A ARG 63 ? ? CZ A ARG 63 ? ? NH1 A ARG 63 ? ? 123.39 120.30 3.09 0.50 N 3 20 CB A PHE 35 ? ? CG A PHE 35 ? ? CD2 A PHE 35 ? ? 116.56 120.80 -4.24 0.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -129.73 -64.85 2 1 ALA A 23 ? ? 46.92 71.11 3 1 ASN A 24 ? ? -77.05 32.27 4 1 SER A 53 ? ? -47.15 159.10 5 1 PRO A 74 ? ? -68.61 -148.78 6 2 ALA A 2 ? ? 53.98 164.01 7 2 ASN A 20 ? ? 176.36 119.78 8 2 TRP A 21 ? ? -90.29 -67.81 9 2 ALA A 23 ? ? 45.16 72.28 10 2 ASN A 24 ? ? -81.74 42.64 11 2 GLN A 34 ? ? 32.54 31.52 12 2 TRP A 73 ? ? -117.71 69.96 13 2 CYS A 76 ? ? -150.32 -60.52 14 3 MET A 3 ? ? -156.26 -56.49 15 3 ALA A 23 ? ? 37.01 76.06 16 3 GLN A 34 ? ? 36.96 40.96 17 3 LYS A 36 ? ? -37.06 132.45 18 3 PRO A 74 ? ? -81.22 -81.90 19 4 ALA A 2 ? ? -166.52 -69.01 20 4 MET A 3 ? ? 45.28 85.76 21 4 ASN A 20 ? ? -177.60 86.07 22 4 ASN A 24 ? ? -80.80 35.52 23 5 ASN A 20 ? ? -59.68 101.42 24 5 ALA A 23 ? ? 37.83 79.14 25 5 ASN A 24 ? ? -87.07 41.22 26 5 GLN A 34 ? ? 36.65 27.44 27 5 LYS A 36 ? ? -29.05 132.79 28 6 ALA A 23 ? ? 39.35 71.77 29 6 ASN A 24 ? ? -73.00 32.58 30 6 PRO A 74 ? ? -68.06 -159.01 31 7 ASN A 20 ? ? -47.29 92.84 32 7 ALA A 23 ? ? 39.19 69.60 33 7 ASN A 24 ? ? -82.51 43.81 34 7 PRO A 74 ? ? -64.88 -154.57 35 8 ALA A 2 ? ? 55.25 155.39 36 8 ALA A 22 ? ? -95.04 41.06 37 8 GLN A 34 ? ? 39.11 27.02 38 8 LYS A 36 ? ? -36.80 129.73 39 8 PRO A 74 ? ? -70.46 -159.57 40 8 CYS A 76 ? ? -65.20 40.55 41 9 MET A 3 ? ? 49.78 86.61 42 9 ALA A 22 ? ? -98.93 40.67 43 9 ASN A 24 ? ? -82.74 30.48 44 9 GLN A 34 ? ? 38.62 52.13 45 9 LYS A 36 ? ? -39.94 137.33 46 9 SER A 53 ? ? -46.87 156.41 47 9 ARG A 54 ? ? -29.34 -67.66 48 10 MET A 3 ? ? 61.85 -174.91 49 10 ALA A 23 ? ? 35.35 70.46 50 10 LYS A 36 ? ? -37.75 130.16 51 10 LEU A 70 ? ? -71.38 21.10 52 11 ASN A 20 ? ? 173.77 107.38 53 11 TRP A 21 ? ? -80.37 -79.33 54 11 ALA A 23 ? ? 50.80 70.61 55 11 ASN A 24 ? ? -78.55 33.74 56 11 LEU A 70 ? ? -65.83 1.85 57 11 CYS A 76 ? ? -113.62 -164.88 58 12 SER A 6 ? ? -57.38 108.92 59 12 ASN A 20 ? ? 178.45 98.19 60 12 GLN A 34 ? ? 37.19 31.65 61 12 SER A 53 ? ? -44.35 159.60 62 12 LEU A 70 ? ? -66.35 4.67 63 12 CYS A 76 ? ? -108.40 -165.69 64 13 MET A 3 ? ? 49.65 84.98 65 13 ASN A 20 ? ? -44.47 91.38 66 13 ALA A 23 ? ? 16.81 76.99 67 13 ASN A 24 ? ? -75.70 34.51 68 13 GLN A 34 ? ? 30.89 40.71 69 13 LYS A 36 ? ? -36.07 126.03 70 13 SER A 53 ? ? -46.65 161.34 71 13 PRO A 74 ? ? -69.93 -85.15 72 14 GLN A 34 ? ? 36.00 34.30 73 14 SER A 53 ? ? -49.43 156.09 74 14 TRP A 73 ? ? -118.20 75.53 75 14 CYS A 76 ? ? -139.95 -69.27 76 15 ALA A 2 ? ? 46.07 80.15 77 15 ASN A 20 ? ? -172.15 81.47 78 15 TRP A 21 ? ? -73.65 -73.69 79 15 ASN A 24 ? ? -77.45 35.21 80 15 GLN A 34 ? ? 37.91 36.66 81 15 PRO A 74 ? ? -67.55 -170.06 82 15 CYS A 76 ? ? -39.26 -83.19 83 16 ALA A 2 ? ? -107.97 74.83 84 16 ALA A 23 ? ? 30.30 71.72 85 16 ASN A 24 ? ? -81.55 40.81 86 16 LEU A 70 ? ? -78.79 24.77 87 16 PRO A 74 ? ? -71.61 -89.21 88 17 ALA A 2 ? ? -165.27 -57.75 89 17 MET A 3 ? ? 67.34 -47.17 90 17 ASN A 20 ? ? -169.79 76.86 91 17 ASN A 24 ? ? -76.00 32.54 92 17 PRO A 74 ? ? -67.39 -153.00 93 18 ALA A 2 ? ? -132.48 -67.71 94 18 ALA A 23 ? ? 40.11 78.12 95 18 ASN A 24 ? ? -83.88 43.41 96 18 GLN A 34 ? ? 42.83 28.52 97 18 LYS A 36 ? ? -24.45 126.12 98 18 PRO A 74 ? ? -63.25 -159.93 99 18 CYS A 76 ? ? -52.60 -135.10 100 19 ASN A 20 ? ? 172.16 108.01 101 19 ALA A 23 ? ? 49.91 84.81 102 20 ALA A 2 ? ? -152.27 -72.51 103 20 ASN A 20 ? ? -52.22 100.29 104 20 ALA A 23 ? ? 16.16 74.00 105 20 ASN A 24 ? ? 43.06 88.64 106 20 TRP A 73 ? ? -118.21 74.80 107 20 CYS A 76 ? ? -142.07 -86.00 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 5 _pdbx_validate_main_chain_plane.auth_comp_id ASN _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 48 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -11.12 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 12 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 30 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.097 _pdbx_validate_planes.type 'SIDE CHAIN' #