data_2N66 # _entry.id 2N66 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104471 RCSB ? ? 2N66 PDB pdb_00002n66 10.2210/pdb2n66/pdb 25753 BMRB ? ? D_1000104471 WWPDB ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25753 BMRB unspecified . 2N69 PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N66 _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2015-08-13 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Singarapu, K.K.' 1 'Tonelli, M.' 2 'Markley, J.L.' 3 'Assadi-Porter, F.' 4 # _citation.id primary _citation.title 'NMR Structure of sweeter mutant of sweet protein Brazzein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Singarapu, K.K.' 1 ? primary 'Tonelli, M.' 2 ? primary 'Markley, J.L.' 3 ? primary 'Assadi-Porter, F.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Defensin-like protein' _entity.formula_weight 6522.450 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation D40K _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Brazzein # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYKEKRNLQCICDYCEY _entity_poly.pdbx_seq_one_letter_code_can QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYKEKRNLQCICDYCEY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ASP n 1 3 LYS n 1 4 CYS n 1 5 LYS n 1 6 LYS n 1 7 VAL n 1 8 TYR n 1 9 GLU n 1 10 ASN n 1 11 TYR n 1 12 PRO n 1 13 VAL n 1 14 SER n 1 15 LYS n 1 16 CYS n 1 17 GLN n 1 18 LEU n 1 19 ALA n 1 20 ASN n 1 21 GLN n 1 22 CYS n 1 23 ASN n 1 24 TYR n 1 25 ASP n 1 26 CYS n 1 27 LYS n 1 28 LEU n 1 29 ASP n 1 30 LYS n 1 31 HIS n 1 32 ALA n 1 33 ARG n 1 34 SER n 1 35 GLY n 1 36 GLU n 1 37 CYS n 1 38 PHE n 1 39 TYR n 1 40 LYS n 1 41 GLU n 1 42 LYS n 1 43 ARG n 1 44 ASN n 1 45 LEU n 1 46 GLN n 1 47 CYS n 1 48 ILE n 1 49 CYS n 1 50 ASP n 1 51 TYR n 1 52 CYS n 1 53 GLU n 1 54 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pentadiplandra brazzeana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 43545 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET24d _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DEF_PENBA _struct_ref.pdbx_db_accession P56552 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N66 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56552 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 54 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 54 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2N66 _struct_ref_seq_dif.mon_id LYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 40 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P56552 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 40 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 40 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCO' 1 4 1 '3D HNCACB' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D 1H-13C NOESY aliphatic' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '2D 1H-13C HSQC' 1 9 1 '3D HCCH-COSY' 1 10 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;1.5 mM [U-100% 13C; U-100% 15N] D40K-1, 1.5 mM [U-100% 13C; U-100% 15N] D40K-2, 1.5 mM [U-100% 13C; U-100% 15N] D40K-3, 1.5 mM [U-100% 13C; U-100% 15N] D40K-4, 1.5 mM [U-100% 13C; U-100% 15N] D40K-5, 1.5 mM [U-100% 13C; U-100% 15N] D40K-6, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2N66 _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N66 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N66 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'chemical shift assignment' CYANA 1 ? 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL 2 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw 3 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 4 ? 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE 5 ? 'Bhattacharya and Montelione' 'data analysis' PSVS 6 ? Goddard 'data analysis' Sparky 7 ? 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS 8 ? 'Bartels et al.' 'chemical shift assignment' XEASY 9 ? ? refinement CYANA 10 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N66 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N66 _struct.title 'NMR Structure of sweeter mutant (D40K) of sweet protein Brazzein,' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N66 _struct_keywords.pdbx_keywords 'PLANT PROTEIN' _struct_keywords.text 'Brazzein, Sweet protein, PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 12 ? GLN A 17 ? PRO A 12 GLN A 17 1 ? 6 HELX_P HELX_P2 2 LEU A 18 ? LYS A 30 ? LEU A 18 LYS A 30 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 4 A CYS 52 1_555 ? ? ? ? ? ? ? 2.005 ? ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 16 A CYS 37 1_555 ? ? ? ? ? ? ? 2.067 ? ? disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 22 A CYS 47 1_555 ? ? ? ? ? ? ? 1.959 ? ? disulf4 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 26 A CYS 49 1_555 ? ? ? ? ? ? ? 1.982 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 34 ? PHE A 38 ? SER A 34 PHE A 38 A 2 GLN A 46 ? ASP A 50 ? GLN A 46 ASP A 50 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id PHE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 38 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 38 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 46 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 46 # _atom_sites.entry_id 2N66 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 TYR 54 54 54 TYR TYR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-08-17 2 'Structure model' 1 1 2019-12-11 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Database references' 4 2 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Database references' 6 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_nmr_software 2 2 'Structure model' pdbx_validate_close_contact 3 2 'Structure model' struct_conn 4 2 'Structure model' struct_ref_seq_dif 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_nmr_software.name' 2 2 'Structure model' '_struct_ref_seq_dif.details' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' 5 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id D40K-1 1.5 ? mM '[U-100% 13C; U-100% 15N]' 1 D40K-2 1.5 ? mM '[U-100% 13C; U-100% 15N]' 1 D40K-3 1.5 ? mM '[U-100% 13C; U-100% 15N]' 1 D40K-4 1.5 ? mM '[U-100% 13C; U-100% 15N]' 1 D40K-5 1.5 ? mM '[U-100% 13C; U-100% 15N]' 1 D40K-6 1.5 ? mM '[U-100% 13C; U-100% 15N]' 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 10 _pdbx_validate_close_contact.auth_atom_id_1 SG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 CYS _pdbx_validate_close_contact.auth_seq_id_1 37 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 SG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 CYS _pdbx_validate_close_contact.auth_seq_id_2 47 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.97 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -90.24 -63.66 2 1 LYS A 3 ? ? 63.13 104.84 3 1 ASN A 10 ? ? -163.48 115.82 4 1 GLU A 41 ? ? 49.27 -163.71 5 1 ASN A 44 ? ? -49.22 163.11 6 1 GLU A 53 ? ? -175.71 142.85 7 2 ASN A 10 ? ? -162.11 115.92 8 2 GLU A 41 ? ? 48.45 -163.80 9 2 ASN A 44 ? ? -48.99 162.33 10 3 ASN A 10 ? ? -172.50 113.45 11 3 GLU A 41 ? ? 49.50 -163.69 12 3 ASN A 44 ? ? -48.87 162.55 13 3 GLU A 53 ? ? -172.34 140.69 14 4 ASN A 10 ? ? -172.67 113.48 15 4 GLU A 41 ? ? 49.35 -163.80 16 4 ASN A 44 ? ? -49.04 163.70 17 4 GLU A 53 ? ? -171.86 140.29 18 5 LYS A 3 ? ? -178.35 -34.95 19 5 ASN A 10 ? ? -175.60 112.88 20 5 GLU A 41 ? ? 49.41 -163.74 21 5 ASN A 44 ? ? -49.05 163.17 22 6 LYS A 3 ? ? -135.90 -75.03 23 6 ASN A 10 ? ? -172.38 113.61 24 6 GLU A 41 ? ? 49.10 -163.69 25 6 ASN A 44 ? ? -48.98 162.74 26 6 GLU A 53 ? ? -172.57 140.50 27 7 ASN A 10 ? ? -178.92 114.66 28 7 GLU A 41 ? ? 49.78 -163.79 29 7 ASN A 44 ? ? -49.05 163.59 30 8 ASN A 10 ? ? -179.91 112.15 31 8 GLU A 41 ? ? 49.07 -164.15 32 8 ASN A 44 ? ? -49.12 164.97 33 8 GLU A 53 ? ? -175.62 143.18 34 9 CYS A 4 ? ? -179.57 -64.23 35 9 ASN A 10 ? ? -179.68 112.48 36 9 GLU A 41 ? ? 49.32 -163.70 37 9 ASN A 44 ? ? -49.00 162.67 38 9 CYS A 52 ? ? -162.42 -169.57 39 9 GLU A 53 ? ? -173.49 140.69 40 10 ASP A 2 ? ? 61.42 96.97 41 10 LYS A 3 ? ? 63.22 105.18 42 10 ASN A 10 ? ? -173.53 114.48 43 10 GLU A 41 ? ? 49.12 -162.86 44 10 ASN A 44 ? ? -48.54 161.94 45 11 ASN A 10 ? ? -179.39 113.32 46 11 GLU A 41 ? ? 49.39 -163.68 47 11 ASN A 44 ? ? -48.82 162.52 48 11 CYS A 52 ? ? -162.94 -169.65 49 11 GLU A 53 ? ? -172.93 141.05 50 12 ASN A 10 ? ? -179.74 110.94 51 12 GLU A 41 ? ? 49.48 -164.22 52 12 ASN A 44 ? ? -49.42 166.10 53 12 GLU A 53 ? ? -174.16 140.70 54 13 ASP A 2 ? ? -177.90 -43.38 55 13 LYS A 3 ? ? -172.26 109.98 56 13 ASN A 10 ? ? 179.67 109.27 57 13 GLU A 41 ? ? 56.82 -163.63 58 14 ASP A 2 ? ? 56.19 -171.45 59 14 ASN A 10 ? ? -172.88 112.47 60 14 GLU A 41 ? ? 49.09 -163.88 61 14 ASN A 44 ? ? -48.94 162.92 62 15 ASP A 2 ? ? -52.93 103.10 63 15 ASN A 10 ? ? 179.39 110.57 64 15 GLU A 41 ? ? 49.40 -163.56 65 15 ASN A 44 ? ? -48.96 162.39 66 16 ASN A 10 ? ? -179.19 113.61 67 16 GLU A 41 ? ? 49.65 -163.94 68 16 ASN A 44 ? ? -49.10 163.66 69 17 ASP A 2 ? ? -118.68 68.32 70 17 ASN A 10 ? ? -179.43 111.44 71 17 GLU A 41 ? ? 50.35 -163.18 72 17 ASN A 44 ? ? -48.62 162.38 73 18 ASP A 2 ? ? 53.64 87.16 74 18 ASN A 10 ? ? -170.72 111.15 75 18 GLU A 41 ? ? 50.16 -163.67 76 18 ASN A 44 ? ? -48.94 163.57 77 18 CYS A 52 ? ? -165.55 -169.94 78 19 ASP A 2 ? ? -60.58 99.01 79 19 ASN A 10 ? ? -179.76 107.10 80 19 GLU A 41 ? ? 49.06 -163.99 81 19 ASN A 44 ? ? -49.02 164.96 82 20 ASP A 2 ? ? 62.01 101.41 83 20 CYS A 4 ? ? -179.47 -65.35 84 20 ASN A 10 ? ? -179.56 113.67 85 20 GLU A 41 ? ? 48.98 -163.58 86 20 ASN A 44 ? ? -48.94 162.19 #