data_2N6Z # _entry.id 2N6Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104500 RCSB ? ? 2N6Z PDB pdb_00002n6z 10.2210/pdb2n6z/pdb 25787 BMRB ? ? D_1000104500 WWPDB ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25787 BMRB unspecified . 2N6Y PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N6Z _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-08-31 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Goodrich, A.C.' 1 'Harden, B.J.' 2 'Frueh, D.P.' 3 # _citation.id primary _citation.title ;Solution Structure of a Nonribosomal Peptide Synthetase Carrier Protein Loaded with Its Substrate Reveals Transient, Well-Defined Contacts. ; _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 137 _citation.page_first 12100 _citation.page_last 12109 _citation.year 2015 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26334259 _citation.pdbx_database_id_DOI 10.1021/jacs.5b07772 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Goodrich, A.C.' 1 ? primary 'Harden, B.J.' 2 ? primary 'Frueh, D.P.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HMWP2 nonribosomal peptide synthetase' _entity.formula_weight 10231.503 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 14-93' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Yersiniabactin biosynthetic protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GTDNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLD(4HJ)IRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLM LSRSPE ; _entity_poly.pdbx_seq_one_letter_code_can ;GTDNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDXIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRS PE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 ASP n 1 4 ASN n 1 5 ARG n 1 6 HIS n 1 7 ALA n 1 8 ALA n 1 9 ASP n 1 10 TYR n 1 11 GLN n 1 12 GLN n 1 13 LEU n 1 14 ARG n 1 15 GLU n 1 16 ARG n 1 17 LEU n 1 18 ILE n 1 19 GLN n 1 20 GLU n 1 21 LEU n 1 22 ASN n 1 23 LEU n 1 24 THR n 1 25 PRO n 1 26 GLN n 1 27 GLN n 1 28 LEU n 1 29 HIS n 1 30 GLU n 1 31 GLU n 1 32 SER n 1 33 ASN n 1 34 LEU n 1 35 ILE n 1 36 GLN n 1 37 ALA n 1 38 GLY n 1 39 LEU n 1 40 ASP n 1 41 4HJ n 1 42 ILE n 1 43 ARG n 1 44 LEU n 1 45 MET n 1 46 ARG n 1 47 TRP n 1 48 LEU n 1 49 HIS n 1 50 TRP n 1 51 PHE n 1 52 ARG n 1 53 LYS n 1 54 ASN n 1 55 GLY n 1 56 TYR n 1 57 ARG n 1 58 LEU n 1 59 THR n 1 60 LEU n 1 61 ARG n 1 62 GLU n 1 63 LEU n 1 64 TYR n 1 65 ALA n 1 66 ALA n 1 67 PRO n 1 68 THR n 1 69 LEU n 1 70 ALA n 1 71 ALA n 1 72 TRP n 1 73 ASN n 1 74 GLN n 1 75 LEU n 1 76 MET n 1 77 LEU n 1 78 SER n 1 79 ARG n 1 80 SER n 1 81 PRO n 1 82 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'irp2, y2399, YPO1911' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Yersinia pestis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 632 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-DUET-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7CI41_YERPE _struct_ref.pdbx_db_accession Q7CI41 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDSIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE ; _struct_ref.pdbx_align_begin 14 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N6Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7CI41 _struct_ref_seq.db_align_beg 14 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 93 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 14 _struct_ref_seq.pdbx_auth_seq_align_end 93 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N6Z GLY A 1 ? UNP Q7CI41 ? ? 'expression tag' 12 1 1 2N6Z THR A 2 ? UNP Q7CI41 ? ? 'expression tag' 13 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4HJ 'L-peptide linking' n ;O-[(R)-hydroxy{[(3R)-3-hydroxy-4-{[3-({2-[(2-hydroxybenzoyl)sulfanyl]ethyl}amino)-3-oxopropyl]amino}-2,2-dimethyl-4-oxobutyl]oxy}phosphoryl]-L-serine ; ? 'C21 H32 N3 O11 P S' 565.531 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '3D HNCO' 1 3 2 '3D HNCA' 1 4 2 '3D HNCACB' 1 5 2 '3D H(CCO)NH' 1 6 2 '3D HN(CA)CO' 1 7 1 '3D 1H-15N NOESY' 1 8 2 '2D 1H-13C HSQC' 1 9 3 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.3-0.4 mM [U-99% 15N] Loaded-ArCP, 50 mM ACES, 0.5 mM TCEP, 150 mM sodium chloride, 1 mM magnesium chloride, 0.1 mM DSS, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.3-0.4 mM [U-99% 13C; U-99% 15N] Loaded-ArCP, 50 mM ACES, 0.5 mM TCEP, 150 mM sodium chloride, 1 mM magnesium chloride, 0.1 mM DSS, 2 mM ATP, 2 mM sodium salicylate, 0.02-0.10 uM Adenylation domain YbtE, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;0.3-0.4 mM [U-99% 13C; U-99% 15N] Loaded-ArCP, 50 mM ACES, 0.5 mM TCEP, 150 mM sodium chloride, 1 mM magnesium chloride, 0.1 mM DSS, 2 mM ATP, 0.5 mM [U-100% 13C] sodium salicylate, 0.02-0.10 uM Adenylation domain YbtE, 100% D2O ; 3 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2N6Z _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N6Z _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N6Z _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 2 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 3 'Keller and Wuthrich' 'data analysis' CARA ? 4 'Keller and Wuthrich' 'peak picking' CARA ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N6Z _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N6Z _struct.title 'Solution structure of the salicylate-loaded ArCP from yersiniabactin synthetase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N6Z _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text 'Carrier Protein, Substrate-Loaded, Nonribosomal Peptide Synthetase, Yersiniabactin, Ligase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 4 ? ALA A 7 ? ASN A 15 ALA A 18 5 ? 4 HELX_P HELX_P2 2 ALA A 8 ? ASN A 22 ? ALA A 19 ASN A 33 1 ? 15 HELX_P HELX_P3 3 ASN A 33 ? ALA A 37 ? ASN A 44 ALA A 48 5 ? 5 HELX_P HELX_P4 4 ASP A 40 ? LYS A 53 ? ASP A 51 LYS A 64 1 ? 14 HELX_P HELX_P5 5 THR A 59 ? ALA A 66 ? THR A 70 ALA A 77 1 ? 8 HELX_P HELX_P6 6 THR A 68 ? SER A 78 ? THR A 79 SER A 89 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 40 C ? ? ? 1_555 A 4HJ 41 N ? ? A ASP 51 A 4HJ 52 1_555 ? ? ? ? ? ? ? 1.301 ? ? covale2 covale both ? A 4HJ 41 C ? ? ? 1_555 A ILE 42 N ? ? A 4HJ 52 A ILE 53 1_555 ? ? ? ? ? ? ? 1.298 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2N6Z _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _database_PDB_caveat.text 'CHIRALITY ERRORS AT CA ATOM OF RESIDUE 4HJ IN MODELS 12, 15, AND 18.' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 12 ? ? ? A . n A 1 2 THR 2 13 ? ? ? A . n A 1 3 ASP 3 14 14 ASP ASP A . n A 1 4 ASN 4 15 15 ASN ASN A . n A 1 5 ARG 5 16 16 ARG ARG A . n A 1 6 HIS 6 17 17 HIS HIS A . n A 1 7 ALA 7 18 18 ALA ALA A . n A 1 8 ALA 8 19 19 ALA ALA A . n A 1 9 ASP 9 20 20 ASP ASP A . n A 1 10 TYR 10 21 21 TYR TYR A . n A 1 11 GLN 11 22 22 GLN GLN A . n A 1 12 GLN 12 23 23 GLN GLN A . n A 1 13 LEU 13 24 24 LEU LEU A . n A 1 14 ARG 14 25 25 ARG ARG A . n A 1 15 GLU 15 26 26 GLU GLU A . n A 1 16 ARG 16 27 27 ARG ARG A . n A 1 17 LEU 17 28 28 LEU LEU A . n A 1 18 ILE 18 29 29 ILE ILE A . n A 1 19 GLN 19 30 30 GLN GLN A . n A 1 20 GLU 20 31 31 GLU GLU A . n A 1 21 LEU 21 32 32 LEU LEU A . n A 1 22 ASN 22 33 33 ASN ASN A . n A 1 23 LEU 23 34 34 LEU LEU A . n A 1 24 THR 24 35 35 THR THR A . n A 1 25 PRO 25 36 36 PRO PRO A . n A 1 26 GLN 26 37 37 GLN GLN A . n A 1 27 GLN 27 38 38 GLN GLN A . n A 1 28 LEU 28 39 39 LEU LEU A . n A 1 29 HIS 29 40 40 HIS HIS A . n A 1 30 GLU 30 41 41 GLU GLU A . n A 1 31 GLU 31 42 42 GLU GLU A . n A 1 32 SER 32 43 43 SER SER A . n A 1 33 ASN 33 44 44 ASN ASN A . n A 1 34 LEU 34 45 45 LEU LEU A . n A 1 35 ILE 35 46 46 ILE ILE A . n A 1 36 GLN 36 47 47 GLN GLN A . n A 1 37 ALA 37 48 48 ALA ALA A . n A 1 38 GLY 38 49 49 GLY GLY A . n A 1 39 LEU 39 50 50 LEU LEU A . n A 1 40 ASP 40 51 51 ASP ASP A . n A 1 41 4HJ 41 52 52 4HJ 4HJ A . n A 1 42 ILE 42 53 53 ILE ILE A . n A 1 43 ARG 43 54 54 ARG ARG A . n A 1 44 LEU 44 55 55 LEU LEU A . n A 1 45 MET 45 56 56 MET MET A . n A 1 46 ARG 46 57 57 ARG ARG A . n A 1 47 TRP 47 58 58 TRP TRP A . n A 1 48 LEU 48 59 59 LEU LEU A . n A 1 49 HIS 49 60 60 HIS HIS A . n A 1 50 TRP 50 61 61 TRP TRP A . n A 1 51 PHE 51 62 62 PHE PHE A . n A 1 52 ARG 52 63 63 ARG ARG A . n A 1 53 LYS 53 64 64 LYS LYS A . n A 1 54 ASN 54 65 65 ASN ASN A . n A 1 55 GLY 55 66 66 GLY GLY A . n A 1 56 TYR 56 67 67 TYR TYR A . n A 1 57 ARG 57 68 68 ARG ARG A . n A 1 58 LEU 58 69 69 LEU LEU A . n A 1 59 THR 59 70 70 THR THR A . n A 1 60 LEU 60 71 71 LEU LEU A . n A 1 61 ARG 61 72 72 ARG ARG A . n A 1 62 GLU 62 73 73 GLU GLU A . n A 1 63 LEU 63 74 74 LEU LEU A . n A 1 64 TYR 64 75 75 TYR TYR A . n A 1 65 ALA 65 76 76 ALA ALA A . n A 1 66 ALA 66 77 77 ALA ALA A . n A 1 67 PRO 67 78 78 PRO PRO A . n A 1 68 THR 68 79 79 THR THR A . n A 1 69 LEU 69 80 80 LEU LEU A . n A 1 70 ALA 70 81 81 ALA ALA A . n A 1 71 ALA 71 82 82 ALA ALA A . n A 1 72 TRP 72 83 83 TRP TRP A . n A 1 73 ASN 73 84 84 ASN ASN A . n A 1 74 GLN 74 85 85 GLN GLN A . n A 1 75 LEU 75 86 86 LEU LEU A . n A 1 76 MET 76 87 87 MET MET A . n A 1 77 LEU 77 88 88 LEU LEU A . n A 1 78 SER 78 89 89 SER SER A . n A 1 79 ARG 79 90 90 ARG ARG A . n A 1 80 SER 80 91 91 SER SER A . n A 1 81 PRO 81 92 92 PRO PRO A . n A 1 82 GLU 82 93 93 GLU GLU A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id 4HJ _pdbx_struct_mod_residue.label_seq_id 41 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id 4HJ _pdbx_struct_mod_residue.auth_seq_id 52 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-23 2 'Structure model' 1 1 2015-09-30 3 'Structure model' 1 2 2015-10-07 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 7 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Loaded-ArCP-1 ? 0.3-0.4 mM '[U-99% 15N]' 1 ACES-2 50 ? mM ? 1 TCEP-3 0.5 ? mM ? 1 'sodium chloride-4' 150 ? mM ? 1 'magnesium chloride-5' 1 ? mM ? 1 DSS-6 0.1 ? mM ? 1 Loaded-ArCP-7 ? 0.3-0.4 mM '[U-99% 13C; U-99% 15N]' 2 ACES-8 50 ? mM ? 2 TCEP-9 0.5 ? mM ? 2 'sodium chloride-10' 150 ? mM ? 2 'magnesium chloride-11' 1 ? mM ? 2 DSS-12 0.1 ? mM ? 2 ATP-13 2 ? mM ? 2 'sodium salicylate-14' 2 ? mM ? 2 'Adenylation domain YbtE-15' ? 0.02-0.10 uM ? 2 Loaded-ArCP-16 ? 0.3-0.4 mM '[U-99% 13C; U-99% 15N]' 3 ACES-17 50 ? mM ? 3 TCEP-18 0.5 ? mM ? 3 'sodium chloride-19' 150 ? mM ? 3 'magnesium chloride-20' 1 ? mM ? 3 DSS-21 0.1 ? mM ? 3 ATP-22 2 ? mM ? 3 'sodium salicylate-23' 0.5 ? mM '[U-100% 13C]' 3 'Adenylation domain YbtE-24' ? 0.02-0.10 uM ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH12 A ARG 90 ? ? O A GLU 93 ? ? 1.57 2 1 OE2 A GLU 31 ? ? HH12 A ARG 57 ? ? 1.59 3 1 HG1 A THR 70 ? ? OE1 A GLU 73 ? ? 1.60 4 1 HH22 A ARG 63 ? ? OE2 A GLU 93 ? ? 1.60 5 1 OD2 A ASP 51 ? ? HH11 A ARG 54 ? ? 1.60 6 2 HH11 A ARG 25 ? ? OE2 A GLU 41 ? ? 1.56 7 3 OD2 A ASP 51 ? ? HH11 A ARG 54 ? ? 1.58 8 4 OE1 A GLU 31 ? ? HH22 A ARG 57 ? ? 1.57 9 5 OE2 A GLU 31 ? ? HH21 A ARG 57 ? ? 1.56 10 6 HH22 A ARG 68 ? ? OE2 A GLU 93 ? ? 1.57 11 6 OE1 A GLU 31 ? ? HH21 A ARG 57 ? ? 1.59 12 6 HH21 A ARG 25 ? ? OE2 A GLU 42 ? ? 1.60 13 6 OD2 A ASP 51 ? ? HH11 A ARG 54 ? ? 1.60 14 7 OD2 A ASP 51 ? ? HH11 A ARG 54 ? ? 1.56 15 7 HZ1 A LYS 64 ? ? OD1 A ASN 65 ? ? 1.58 16 8 OE2 A GLU 31 ? ? HH12 A ARG 57 ? ? 1.59 17 8 OD2 A ASP 51 ? ? HH11 A ARG 54 ? ? 1.60 18 9 OE1 A GLU 31 ? ? HH21 A ARG 54 ? ? 1.56 19 9 HH21 A ARG 25 ? ? OE2 A GLU 41 ? ? 1.59 20 10 OD2 A ASP 51 ? ? HH11 A ARG 54 ? ? 1.57 21 11 OD1 A ASP 14 ? ? H A ASN 15 ? ? 1.55 22 11 OE1 A GLU 31 ? ? HH22 A ARG 57 ? ? 1.56 23 11 OD2 A ASP 51 ? ? HH11 A ARG 54 ? ? 1.60 24 13 HH21 A ARG 90 ? ? OXT A GLU 93 ? ? 1.53 25 13 OE2 A GLU 31 ? ? HH22 A ARG 57 ? ? 1.60 26 14 OD2 A ASP 51 ? ? HH11 A ARG 54 ? ? 1.60 27 15 HH21 A ARG 90 ? ? OE2 A GLU 93 ? ? 1.58 28 15 OD2 A ASP 14 ? ? HH21 A ARG 16 ? ? 1.60 29 16 HH11 A ARG 68 ? ? OXT A GLU 93 ? ? 1.56 30 16 OD2 A ASP 51 ? ? HH11 A ARG 54 ? ? 1.59 31 16 OE2 A GLU 31 ? ? HH12 A ARG 57 ? ? 1.60 32 17 OD2 A ASP 51 ? ? HH11 A ARG 54 ? ? 1.59 33 18 OE2 A GLU 31 ? ? HH12 A ARG 57 ? ? 1.58 34 18 OD2 A ASP 51 ? ? HH11 A ARG 54 ? ? 1.60 35 20 OE1 A GLU 31 ? ? HH22 A ARG 57 ? ? 1.58 36 20 OE1 A GLU 31 ? ? HH11 A ARG 54 ? ? 1.60 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 16 _pdbx_validate_rmsd_bond.auth_atom_id_1 CA _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 SER _pdbx_validate_rmsd_bond.auth_seq_id_1 89 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CB _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 SER _pdbx_validate_rmsd_bond.auth_seq_id_2 89 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.420 _pdbx_validate_rmsd_bond.bond_target_value 1.525 _pdbx_validate_rmsd_bond.bond_deviation -0.105 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.015 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 69 ? ? -171.54 149.32 2 1 ARG A 90 ? ? 48.21 -67.28 3 1 SER A 91 ? ? 150.30 105.34 4 1 PRO A 92 ? ? -0.89 -83.58 5 2 ASN A 15 ? ? 41.82 -154.36 6 2 PRO A 36 ? ? -57.83 -4.69 7 2 SER A 91 ? ? 32.84 76.78 8 2 PRO A 92 ? ? -57.13 105.15 9 3 ARG A 90 ? ? 64.26 -56.73 10 4 ARG A 90 ? ? -10.79 68.79 11 4 SER A 91 ? ? -154.30 -55.39 12 5 ARG A 90 ? ? 64.38 -76.75 13 5 SER A 91 ? ? -159.98 84.20 14 6 ASN A 44 ? ? -38.17 106.02 15 6 ARG A 90 ? ? 61.86 -26.79 16 6 SER A 91 ? ? 71.23 82.38 17 6 PRO A 92 ? ? -11.79 -56.25 18 7 ASP A 51 ? ? -130.37 -133.47 19 7 4HJ A 52 ? ? -99.99 -74.01 20 7 ARG A 90 ? ? 69.46 -55.64 21 8 ASN A 15 ? ? 179.48 178.50 22 8 ARG A 90 ? ? 66.71 -65.77 23 8 SER A 91 ? ? -159.03 76.39 24 9 ASN A 15 ? ? -155.28 -130.21 25 9 ASP A 51 ? ? -114.18 -138.44 26 9 4HJ A 52 ? ? -95.87 -74.03 27 9 ILE A 53 ? ? -37.55 -39.38 28 9 ARG A 90 ? ? 69.66 -33.44 29 10 ALA A 18 ? ? -42.95 -16.01 30 10 TYR A 67 ? ? -58.01 108.50 31 10 ARG A 90 ? ? 68.19 -16.45 32 10 SER A 91 ? ? 68.07 88.99 33 10 PRO A 92 ? ? -37.40 148.41 34 11 ASN A 15 ? ? -139.59 -90.18 35 11 ASP A 51 ? ? -128.71 -141.20 36 11 4HJ A 52 ? ? -94.27 -68.25 37 11 ARG A 90 ? ? 70.65 -25.10 38 11 SER A 91 ? ? -136.14 -54.30 39 12 ALA A 18 ? ? -45.55 -14.28 40 12 ASP A 51 ? ? -130.28 -146.00 41 12 4HJ A 52 ? ? -94.58 -70.54 42 12 ARG A 90 ? ? 21.15 59.93 43 12 SER A 91 ? ? -159.33 -65.38 44 13 ASN A 15 ? ? -168.57 87.41 45 13 ASN A 33 ? ? 55.62 70.86 46 13 ASP A 51 ? ? -126.05 -155.81 47 13 ARG A 68 ? ? -64.68 90.07 48 13 ARG A 90 ? ? -19.60 68.20 49 13 SER A 91 ? ? -164.84 -61.72 50 14 ASN A 33 ? ? 56.39 70.71 51 14 SER A 91 ? ? 69.24 121.40 52 15 ASN A 15 ? ? -160.02 109.11 53 15 ALA A 18 ? ? -44.05 -15.40 54 15 ARG A 90 ? ? -29.20 78.46 55 15 SER A 91 ? ? -146.97 -62.03 56 17 ASN A 15 ? ? -170.64 126.55 57 17 ASN A 44 ? ? -40.24 108.50 58 17 LEU A 69 ? ? -172.41 134.81 59 17 SER A 91 ? ? 107.86 -36.36 60 18 ALA A 18 ? ? -43.39 -14.23 61 18 ARG A 90 ? ? 5.80 64.57 62 18 SER A 91 ? ? -171.34 -61.39 63 19 ASN A 15 ? ? -163.13 23.71 64 19 ALA A 18 ? ? -45.21 -15.88 65 19 ASP A 51 ? ? -129.61 -165.73 66 20 ASP A 51 ? ? -84.78 -120.75 67 20 4HJ A 52 ? ? -107.00 -72.05 68 20 ARG A 90 ? ? 55.93 -38.26 69 20 SER A 91 ? ? 84.99 84.52 70 20 PRO A 92 ? ? -28.57 122.69 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 7 4HJ A 52 ? ? -12.26 2 9 4HJ A 52 ? ? -12.21 3 11 4HJ A 52 ? ? -12.04 4 12 4HJ A 52 ? ? -12.47 5 20 4HJ A 52 ? ? -13.23 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 ARG A 25 ? ? 0.070 'SIDE CHAIN' 2 4 ARG A 90 ? ? 0.116 'SIDE CHAIN' 3 6 ARG A 90 ? ? 0.096 'SIDE CHAIN' 4 7 ARG A 90 ? ? 0.103 'SIDE CHAIN' 5 9 ARG A 27 ? ? 0.088 'SIDE CHAIN' 6 11 ARG A 25 ? ? 0.094 'SIDE CHAIN' 7 12 ARG A 57 ? ? 0.107 'SIDE CHAIN' 8 13 ARG A 27 ? ? 0.085 'SIDE CHAIN' 9 17 ARG A 90 ? ? 0.116 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 12 ? A GLY 1 2 1 Y 1 A THR 13 ? A THR 2 3 2 Y 1 A GLY 12 ? A GLY 1 4 2 Y 1 A THR 13 ? A THR 2 5 3 Y 1 A GLY 12 ? A GLY 1 6 3 Y 1 A THR 13 ? A THR 2 7 4 Y 1 A GLY 12 ? A GLY 1 8 4 Y 1 A THR 13 ? A THR 2 9 5 Y 1 A GLY 12 ? A GLY 1 10 5 Y 1 A THR 13 ? A THR 2 11 6 Y 1 A GLY 12 ? A GLY 1 12 6 Y 1 A THR 13 ? A THR 2 13 7 Y 1 A GLY 12 ? A GLY 1 14 7 Y 1 A THR 13 ? A THR 2 15 8 Y 1 A GLY 12 ? A GLY 1 16 8 Y 1 A THR 13 ? A THR 2 17 9 Y 1 A GLY 12 ? A GLY 1 18 9 Y 1 A THR 13 ? A THR 2 19 10 Y 1 A GLY 12 ? A GLY 1 20 10 Y 1 A THR 13 ? A THR 2 21 11 Y 1 A GLY 12 ? A GLY 1 22 11 Y 1 A THR 13 ? A THR 2 23 12 Y 1 A GLY 12 ? A GLY 1 24 12 Y 1 A THR 13 ? A THR 2 25 13 Y 1 A GLY 12 ? A GLY 1 26 13 Y 1 A THR 13 ? A THR 2 27 14 Y 1 A GLY 12 ? A GLY 1 28 14 Y 1 A THR 13 ? A THR 2 29 15 Y 1 A GLY 12 ? A GLY 1 30 15 Y 1 A THR 13 ? A THR 2 31 16 Y 1 A GLY 12 ? A GLY 1 32 16 Y 1 A THR 13 ? A THR 2 33 17 Y 1 A GLY 12 ? A GLY 1 34 17 Y 1 A THR 13 ? A THR 2 35 18 Y 1 A GLY 12 ? A GLY 1 36 18 Y 1 A THR 13 ? A THR 2 37 19 Y 1 A GLY 12 ? A GLY 1 38 19 Y 1 A THR 13 ? A THR 2 39 20 Y 1 A GLY 12 ? A GLY 1 40 20 Y 1 A THR 13 ? A THR 2 #