data_2N7B # _entry.id 2N7B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id RCSB104512 RCSB 2N7B PDB 25799 BMRB D_1000104512 WWPDB # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25799 BMRB unspecified . 2N7A PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N7B _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-09-07 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Proepster, J.M.' 1 'Yang, F.' 2 'Rabbani, S.' 3 'Ernst, B.' 4 'Allain, F.H.-T.' 5 'Schubert, M.' 6 # _citation.id primary _citation.title 'Structural basis for sulfation-dependent self-glycan recognition by the human immune-inhibitory receptor Siglec-8.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 113 _citation.page_first E4170 _citation.page_last E4179 _citation.year 2016 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27357658 _citation.pdbx_database_id_DOI 10.1073/pnas.1602214113 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Propster, J.M.' 1 ? primary 'Yang, F.' 2 ? primary 'Rabbani, S.' 3 ? primary 'Ernst, B.' 4 ? primary 'Allain, F.H.' 5 ? primary 'Schubert, M.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Sialic acid-binding Ig-like lectin 8' 16665.463 1 ? C26S 'N-terminal lectin domain (UNP residues 17-155)' ? 2 branched man ;N-acetyl-alpha-neuraminic acid-(2-3)-6-O-sulfo-beta-D-galactopyranose-(1-4)-[alpha-L-fucopyranose-(1-3)]2-acetamido-2-deoxy-beta-D-glucopyranose ; 900.807 1 ? ? ? ? 3 non-polymer syn 3-aminopropan-1-ol 75.110 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Siglec-8, Sialoadhesin family member 2, SAF-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEGDRQYGDGYLLQVQELVTVQEGLSVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRF QLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTHGSLVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MEGDRQYGDGYLLQVQELVTVQEGLSVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRF QLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTHGSLVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 GLY n 1 4 ASP n 1 5 ARG n 1 6 GLN n 1 7 TYR n 1 8 GLY n 1 9 ASP n 1 10 GLY n 1 11 TYR n 1 12 LEU n 1 13 LEU n 1 14 GLN n 1 15 VAL n 1 16 GLN n 1 17 GLU n 1 18 LEU n 1 19 VAL n 1 20 THR n 1 21 VAL n 1 22 GLN n 1 23 GLU n 1 24 GLY n 1 25 LEU n 1 26 SER n 1 27 VAL n 1 28 HIS n 1 29 VAL n 1 30 PRO n 1 31 CYS n 1 32 SER n 1 33 PHE n 1 34 SER n 1 35 TYR n 1 36 PRO n 1 37 GLN n 1 38 ASP n 1 39 GLY n 1 40 TRP n 1 41 THR n 1 42 ASP n 1 43 SER n 1 44 ASP n 1 45 PRO n 1 46 VAL n 1 47 HIS n 1 48 GLY n 1 49 TYR n 1 50 TRP n 1 51 PHE n 1 52 ARG n 1 53 ALA n 1 54 GLY n 1 55 ASP n 1 56 ARG n 1 57 PRO n 1 58 TYR n 1 59 GLN n 1 60 ASP n 1 61 ALA n 1 62 PRO n 1 63 VAL n 1 64 ALA n 1 65 THR n 1 66 ASN n 1 67 ASN n 1 68 PRO n 1 69 ASP n 1 70 ARG n 1 71 GLU n 1 72 VAL n 1 73 GLN n 1 74 ALA n 1 75 GLU n 1 76 THR n 1 77 GLN n 1 78 GLY n 1 79 ARG n 1 80 PHE n 1 81 GLN n 1 82 LEU n 1 83 LEU n 1 84 GLY n 1 85 ASP n 1 86 ILE n 1 87 TRP n 1 88 SER n 1 89 ASN n 1 90 ASP n 1 91 CYS n 1 92 SER n 1 93 LEU n 1 94 SER n 1 95 ILE n 1 96 ARG n 1 97 ASP n 1 98 ALA n 1 99 ARG n 1 100 LYS n 1 101 ARG n 1 102 ASP n 1 103 LYS n 1 104 GLY n 1 105 SER n 1 106 TYR n 1 107 PHE n 1 108 PHE n 1 109 ARG n 1 110 LEU n 1 111 GLU n 1 112 ARG n 1 113 GLY n 1 114 SER n 1 115 MET n 1 116 LYS n 1 117 TRP n 1 118 SER n 1 119 TYR n 1 120 LYS n 1 121 SER n 1 122 GLN n 1 123 LEU n 1 124 ASN n 1 125 TYR n 1 126 LYS n 1 127 THR n 1 128 LYS n 1 129 GLN n 1 130 LEU n 1 131 SER n 1 132 VAL n 1 133 PHE n 1 134 VAL n 1 135 THR n 1 136 ALA n 1 137 LEU n 1 138 THR n 1 139 HIS n 1 140 GLY n 1 141 SER n 1 142 LEU n 1 143 VAL n 1 144 PRO n 1 145 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SIGLEC8, SAF2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant SIGLEC8 _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta-gami B (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-43.1a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SIGL8_HUMAN _struct_ref.pdbx_db_accession Q9NYZ4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRF QLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTH ; _struct_ref.pdbx_align_begin 17 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N7B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 139 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NYZ4 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 155 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 139 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N7B SER A 26 ? UNP Q9NYZ4 CYS 42 'engineered mutation' 26 1 1 2N7B GLY A 140 ? UNP Q9NYZ4 ? ? 'expression tag' 140 2 1 2N7B SER A 141 ? UNP Q9NYZ4 ? ? 'expression tag' 141 3 1 2N7B LEU A 142 ? UNP Q9NYZ4 ? ? 'expression tag' 142 4 1 2N7B VAL A 143 ? UNP Q9NYZ4 ? ? 'expression tag' 143 5 1 2N7B PRO A 144 ? UNP Q9NYZ4 ? ? 'expression tag' 144 6 1 2N7B ARG A 145 ? UNP Q9NYZ4 ? ? 'expression tag' 145 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0D8 non-polymer . 3-aminopropan-1-ol ? 'C3 H9 N O' 75.110 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose ? 'C6 H12 O5' 164.156 G6S 'D-saccharide, beta linking' n 6-O-sulfo-beta-D-galactopyranose ? 'C6 H12 O9 S' 260.219 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SIA 'D-saccharide, alpha linking' . 'N-acetyl-alpha-neuraminic acid' ? 'C11 H19 N O9' 309.270 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC aliphatic' 1 3 2 '2D 1H-13C HSQC aromatic' 1 4 2 '3D HNCA' 1 5 2 '3D HNCACB' 1 6 2 '3D CBCA(CO)NH' 1 7 2 '3D HNCO' 1 8 2 '3D HN(CO)CA' 1 9 3 '3D HCCH-TOCSY' 1 10 2 '3D 1H-15N NOESY' 1 11 4 '2D 1H-1H NOESY' 1 12 2 '3D 1H-13C NOESY aliphatic' 1 13 2 '3D 1H-13C NOESY aromatic' 1 14 4 '2D 1H-1H TOCSY' 1 15 3 '2D 13C F2-filtered NOESY' 1 16 3 '2D 13C F1-filtered TOCSY' 1 17 2 '2D 13C F1-filtered TOCSY' 2 18 3 '2D 13C F1-filtered F2-filtered NOESY' 2 19 3 '3D 13C F1-edited F3-filtered NOESY' 2 20 1 '2D 13C/15N F2-filtered NOESY' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 0.092 7.4 ambient ? 293 K 2 0.092 7.4 ambient ? 303 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.7-1.2 mM [U-100% 15N] Siglec, 20 mM potassium phosphate, 40 mM sodium chloride, 0.7-2.4 mM SUGAR (5-MER), 95% H2O/5% D2O' 1 '95% H2O/5% D2O' ;0.3-1.2 mM [U-100% 13C; U-100% 15N] Siglec, 20 mM potassium phosphate, 40 mM sodium chloride, 0.7-2.4 mM SUGAR (5-MER), 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' '0.3-1.2 mM [U-100% 13C; U-100% 15N] Siglec, 20 mM potassium phosphate, 40 mM sodium chloride, 0.7-2.4 mM SUGAR (5-MER), 100% D2O' 3 '100% D2O' '0.3-1.2 mM [U-100% 15N] Siglec, 20 mM potassium phosphate, 40 mM sodium chloride, 0.7-2.4 mM SUGAR (5-MER), 100% D2O' 4 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' 700 Bruker AVANCE 3 'Bruker Avance' 750 Bruker AVANCE 4 'Bruker Avance' 900 Bruker AVANCE 5 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2N7B _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N7B _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N7B _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 3.0 1 'Bruker Biospin' 'data analysis' TopSpin 3.0 2 'Bruker Biospin' processing TopSpin 3.0 3 Goddard 'chemical shift assignment' Sparky 3.114 4 Goddard 'data analysis' Sparky 3.114 5 'Herrmann, Guntert and Wuthrich' 'peak picking' ATNOS/CANDID 2.1 6 'Guntert, Mumenthaler and Wuthrich' 'structure calculation' CYANA 3.0 7 'Cornilescu, Delaglio and Bax' 'protein backbone torsion angle prediction from nmr chemical shifts' TALOS+ ? 8 'Laskowski and MacArthur' validation ProcheckNMR v.3.5.4 9 'Case, D.A. et al.' refinement Amber 12 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N7B _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N7B _struct.title ;Solution structure of the human Siglec-8 lectin domain in complex with 6'sulfo sialyl Lewisx ; _struct.pdbx_descriptor 'Sialic acid-binding Ig-like lectin 8' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N7B _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text ;Sialic acid-binding immunoglobulin-like lectin 8, Siglec8, SAF-2, I-type lectin, carbohydrate-binding receptor, carbohydrate recognition, protein-glycan complex, sulfated sialyl Lewis X, STRUCTURAL PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 91 SG ? ? A CYS 31 A CYS 91 1_555 ? ? ? ? ? ? ? 2.043 ? ? covale1 covale both ? C 0D8 . OH ? ? ? 1_555 B NAG . C1 ? ? A 0D8 201 B NAG 1 1_555 ? ? ? ? ? ? ? 1.463 ? ? covale2 covale both ? B NAG . O4 ? ? ? 1_555 B G6S . C1 ? ? B NAG 1 B G6S 2 1_555 ? ? ? ? ? ? ? 1.464 ? ? covale3 covale both ? B NAG . O3 ? ? ? 1_555 B FUC . C1 ? ? B NAG 1 B FUC 4 1_555 ? ? ? ? ? ? ? 1.471 ? ? covale4 covale both ? B G6S . O3 ? ? ? 1_555 B SIA . C2 ? ? B G6S 2 B SIA 3 1_555 ? ? ? ? ? ? ? 1.423 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 5 ? C ? 4 ? D ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 12 ? VAL A 15 ? LEU A 12 VAL A 15 A 2 CYS A 31 ? SER A 34 ? CYS A 31 SER A 34 B 1 LEU A 18 ? GLN A 22 ? LEU A 18 GLN A 22 B 2 LEU A 130 ? THR A 135 ? LEU A 130 THR A 135 B 3 GLY A 104 ? ARG A 112 ? GLY A 104 ARG A 112 B 4 HIS A 47 ? ARG A 52 ? HIS A 47 ARG A 52 B 5 ALA A 64 ? THR A 65 ? ALA A 64 THR A 65 C 1 LEU A 18 ? GLN A 22 ? LEU A 18 GLN A 22 C 2 LEU A 130 ? THR A 135 ? LEU A 130 THR A 135 C 3 GLY A 104 ? ARG A 112 ? GLY A 104 ARG A 112 C 4 MET A 115 ? SER A 118 ? MET A 115 SER A 118 D 1 VAL A 27 ? VAL A 29 ? VAL A 27 VAL A 29 D 2 LEU A 93 ? ILE A 95 ? LEU A 93 ILE A 95 D 3 PHE A 80 ? LEU A 82 ? PHE A 80 LEU A 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 14 ? N GLN A 14 O SER A 32 ? O SER A 32 B 1 2 N VAL A 19 ? N VAL A 19 O SER A 131 ? O SER A 131 B 2 3 O LEU A 130 ? O LEU A 130 N TYR A 106 ? N TYR A 106 B 3 4 O ARG A 109 ? O ARG A 109 N TYR A 49 ? N TYR A 49 B 4 5 N TRP A 50 ? N TRP A 50 O ALA A 64 ? O ALA A 64 C 1 2 N VAL A 19 ? N VAL A 19 O SER A 131 ? O SER A 131 C 2 3 O LEU A 130 ? O LEU A 130 N TYR A 106 ? N TYR A 106 C 3 4 N LEU A 110 ? N LEU A 110 O TRP A 117 ? O TRP A 117 D 1 2 N VAL A 29 ? N VAL A 29 O LEU A 93 ? O LEU A 93 D 2 3 O SER A 94 ? O SER A 94 N GLN A 81 ? N GLN A 81 # _atom_sites.entry_id 2N7B _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 TRP 87 87 87 TRP TRP A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 MET 115 115 115 MET MET A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 TRP 117 117 117 TRP TRP A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 ARG 145 145 145 ARG ARG A . n # _pdbx_nonpoly_scheme.asym_id C _pdbx_nonpoly_scheme.entity_id 3 _pdbx_nonpoly_scheme.mon_id 0D8 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 146 _pdbx_nonpoly_scheme.pdb_mon_id 0D8 _pdbx_nonpoly_scheme.auth_mon_id 0D8 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-06 2 'Structure model' 1 1 2016-07-27 3 'Structure model' 1 2 2016-08-03 4 'Structure model' 1 3 2016-10-12 5 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Atomic model' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' atom_site 2 5 'Structure model' chem_comp 3 5 'Structure model' entity 4 5 'Structure model' pdbx_branch_scheme 5 5 'Structure model' pdbx_chem_comp_identifier 6 5 'Structure model' pdbx_entity_branch 7 5 'Structure model' pdbx_entity_branch_descriptor 8 5 'Structure model' pdbx_entity_branch_link 9 5 'Structure model' pdbx_entity_branch_list 10 5 'Structure model' pdbx_entity_nonpoly 11 5 'Structure model' pdbx_nmr_software 12 5 'Structure model' pdbx_nmr_spectrometer 13 5 'Structure model' pdbx_nonpoly_scheme 14 5 'Structure model' pdbx_struct_assembly_gen 15 5 'Structure model' struct_asym 16 5 'Structure model' struct_conn 17 5 'Structure model' struct_ref_seq_dif 18 5 'Structure model' struct_site 19 5 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_atom_site.Cartn_x' 2 5 'Structure model' '_atom_site.Cartn_y' 3 5 'Structure model' '_atom_site.Cartn_z' 4 5 'Structure model' '_atom_site.auth_asym_id' 5 5 'Structure model' '_atom_site.auth_atom_id' 6 5 'Structure model' '_atom_site.auth_comp_id' 7 5 'Structure model' '_atom_site.auth_seq_id' 8 5 'Structure model' '_atom_site.label_asym_id' 9 5 'Structure model' '_atom_site.label_atom_id' 10 5 'Structure model' '_atom_site.label_comp_id' 11 5 'Structure model' '_atom_site.label_entity_id' 12 5 'Structure model' '_atom_site.type_symbol' 13 5 'Structure model' '_chem_comp.mon_nstd_flag' 14 5 'Structure model' '_chem_comp.name' 15 5 'Structure model' '_chem_comp.type' 16 5 'Structure model' '_pdbx_nmr_software.name' 17 5 'Structure model' '_pdbx_nmr_spectrometer.model' 18 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 19 5 'Structure model' '_struct_conn.pdbx_dist_value' 20 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 21 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 22 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 26 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 27 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 28 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 29 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Siglec-8-1 ? 0.7-1.2 mM '[U-100% 15N]' 1 'potassium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 40 ? mM ? 1 'SUGAR (5-MER)-4' ? 0.7-2.4 mM ? 1 Siglec-8-5 ? 0.3-1.2 mM '[U-100% 13C; U-100% 15N]' 2 'potassium phosphate-6' 20 ? mM ? 2 'sodium chloride-7' 40 ? mM ? 2 'SUGAR (5-MER)-8' ? 0.7-2.4 mM ? 2 Siglec-8-9 ? 0.3-1.2 mM '[U-100% 13C; U-100% 15N]' 3 'potassium phosphate-10' 20 ? mM ? 3 'sodium chloride-11' 40 ? mM ? 3 'SUGAR (5-MER)-12' ? 0.7-2.4 mM ? 3 Siglec-8-13 ? 0.3-1.2 mM '[U-100% 15N]' 4 'potassium phosphate-14' 20 ? mM ? 4 'sodium chloride-15' 40 ? mM ? 4 'SUGAR (5-MER)-16' ? 0.7-2.4 mM ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 138 ? ? 54.32 11.87 2 1 HIS A 139 ? ? -144.33 19.10 3 1 LEU A 142 ? ? 59.59 13.83 4 2 ASP A 4 ? ? 60.54 169.51 5 2 GLN A 37 ? ? -90.26 35.99 6 2 GLN A 59 ? ? -153.39 -22.01 7 2 THR A 138 ? ? 53.94 18.12 8 3 GLN A 37 ? ? -89.63 35.94 9 3 GLN A 59 ? ? -152.97 -20.97 10 3 THR A 138 ? ? 54.45 12.63 11 3 LEU A 142 ? ? -67.71 2.87 12 4 GLN A 37 ? ? -89.58 35.88 13 4 GLN A 59 ? ? -132.91 -32.17 14 4 THR A 138 ? ? 56.57 -9.50 15 5 GLN A 59 ? ? -135.59 -33.97 16 5 THR A 138 ? ? 54.43 15.16 17 5 VAL A 143 ? ? 61.58 130.10 18 6 GLN A 37 ? ? -89.83 36.11 19 6 GLN A 59 ? ? -134.02 -34.65 20 6 THR A 138 ? ? 53.73 11.40 21 6 HIS A 139 ? ? -144.15 15.10 22 7 GLN A 59 ? ? -152.57 -23.67 23 7 THR A 138 ? ? 53.89 18.02 24 7 VAL A 143 ? ? 62.76 133.52 25 8 GLN A 59 ? ? -151.43 -21.60 26 8 GLN A 122 ? ? -144.71 -158.44 27 8 THR A 138 ? ? 54.07 14.53 28 8 HIS A 139 ? ? -143.05 19.84 29 9 GLN A 37 ? ? -90.24 36.07 30 9 GLN A 59 ? ? -135.35 -32.54 31 9 THR A 138 ? ? 54.43 13.78 32 10 GLN A 37 ? ? -87.99 36.12 33 10 GLN A 59 ? ? -153.18 -21.67 34 10 THR A 138 ? ? 54.93 11.99 35 10 VAL A 143 ? ? 65.56 139.30 36 11 GLN A 59 ? ? -130.07 -35.74 37 11 THR A 138 ? ? 54.59 13.26 38 12 THR A 138 ? ? 55.54 2.92 39 13 GLN A 122 ? ? -142.40 -156.37 40 13 THR A 138 ? ? 55.08 11.54 41 14 GLN A 59 ? ? -151.80 -21.79 42 14 THR A 138 ? ? 53.69 12.24 43 14 HIS A 139 ? ? -148.02 22.02 44 15 THR A 138 ? ? 54.35 12.41 45 16 GLN A 37 ? ? -88.45 35.81 46 16 GLN A 59 ? ? -151.48 -22.66 47 16 GLN A 122 ? ? -141.71 -159.75 48 16 THR A 138 ? ? 54.71 12.64 49 17 ASP A 4 ? ? 60.56 166.66 50 17 GLN A 37 ? ? -90.21 35.90 51 17 GLN A 59 ? ? -152.59 -23.74 52 17 GLN A 122 ? ? -142.79 -154.70 53 17 THR A 138 ? ? 53.97 9.59 54 17 HIS A 139 ? ? -148.76 19.49 55 18 GLN A 37 ? ? -88.60 36.00 56 18 GLN A 59 ? ? -151.32 -20.53 57 18 THR A 138 ? ? 55.04 14.11 58 18 SER A 141 ? ? -156.76 -37.77 59 19 GLN A 59 ? ? -151.55 25.92 60 19 GLN A 122 ? ? -146.05 -159.36 61 19 THR A 138 ? ? 54.43 12.48 62 19 VAL A 143 ? ? 62.44 130.71 63 20 ASP A 4 ? ? 62.69 163.73 64 20 GLN A 37 ? ? -90.16 36.31 65 20 GLN A 59 ? ? -151.50 -24.06 66 20 THR A 138 ? ? 55.17 11.37 67 20 SER A 141 ? ? 56.72 -172.08 68 20 LEU A 142 ? ? 57.62 12.87 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 A NAG 147 n B 2 G6S 2 B G6S 2 A G6S 149 n B 2 SIA 3 B SIA 3 A SIA 150 n B 2 FUC 4 B FUC 4 A FUC 148 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 LFucpa FUC 'COMMON NAME' GMML 1.0 a-L-fucopyranose FUC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-L-Fucp FUC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Fuc G6S 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 'DGalp[6S]b' G6S 'COMMON NAME' GMML 1.0 6-sulfo-b-D-galactopyranose G6S 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp6SO3 NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc SIA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DNeup5Aca SIA 'COMMON NAME' GMML 1.0 'N-acetyl-a-D-neuraminic acid' SIA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Neup5Ac SIA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Neu5Ac # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'DNeup5Aca2-3DGalp[6S]b1-4[LFucpa1-3]DGlcpNAcb1-ROH' 'Glycam Condensed Sequence' GMML 1.0 2 2 ;WURCS=2.0/4,4,3/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5][a2112h-1b_1-5_6*OSO/3=O/3=O][Aad21122h-2a_2-6_5*NCC/3=O]/1-2-3-4/a3-b1_a4-c1_c3-d2 ; WURCS PDB2Glycan 1.1.0 3 2 '[][D-1-deoxy-GlcpNAc]{[(3+1)][a-L-Fucp]{}[(4+1)][b-D-Galp6SO3]{[(3+2)][a-D-Neup5Ac]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 G6S C1 O1 1 NAG O4 HO4 sing ? 2 2 3 SIA C2 O2 2 G6S O3 HO3 sing ? 3 2 4 FUC C1 O1 1 NAG O3 HO3 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 G6S 2 n 2 SIA 3 n 2 FUC 4 n # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 3-aminopropan-1-ol _pdbx_entity_nonpoly.comp_id 0D8 #