data_2N7I # _entry.id 2N7I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104519 RCSB ? ? 2N7I PDB pdb_00002n7i 10.2210/pdb2n7i/pdb 25806 BMRB ? 10.13018/BMR25806 D_1000104519 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-05-18 2 'Structure model' 1 1 2016-05-25 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N7I _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-09-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 25806 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bugge, K.' 1 'Kragelund, B.B.' 2 # _citation.id primary _citation.title 'A combined computational and structural model of the full-length human prolactin receptor.' _citation.journal_abbrev 'Nat Commun' _citation.journal_volume 7 _citation.page_first 11578 _citation.page_last 11578 _citation.year 2016 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2041-1723 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27174498 _citation.pdbx_database_id_DOI 10.1038/ncomms11578 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bugge, K.' 1 ? primary 'Papaleo, E.' 2 ? primary 'Haxholm, G.W.' 3 ? primary 'Hopper, J.T.' 4 ? primary 'Robinson, C.V.' 5 ? primary 'Olsen, J.G.' 6 ? primary 'Lindorff-Larsen, K.' 7 ? primary 'Kragelund, B.B.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Prolactin receptor' _entity.formula_weight 3960.745 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Helical transmembrane domain residues 230-264' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name PRL-R # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMV _entity_poly.pdbx_seq_one_letter_code_can GSFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PHE n 1 4 THR n 1 5 MET n 1 6 ASN n 1 7 ASP n 1 8 THR n 1 9 THR n 1 10 VAL n 1 11 TRP n 1 12 ILE n 1 13 SER n 1 14 VAL n 1 15 ALA n 1 16 VAL n 1 17 LEU n 1 18 SER n 1 19 ALA n 1 20 VAL n 1 21 ILE n 1 22 CYS n 1 23 LEU n 1 24 ILE n 1 25 ILE n 1 26 VAL n 1 27 TRP n 1 28 ALA n 1 29 VAL n 1 30 ALA n 1 31 LEU n 1 32 LYS n 1 33 GLY n 1 34 TYR n 1 35 SER n 1 36 MET n 1 37 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PRLR _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pGEX 4T-1' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 204 204 GLY GLY A . n A 1 2 SER 2 205 205 SER SER A . n A 1 3 PHE 3 206 206 PHE PHE A . n A 1 4 THR 4 207 207 THR THR A . n A 1 5 MET 5 208 208 MET MET A . n A 1 6 ASN 6 209 209 ASN ASN A . n A 1 7 ASP 7 210 210 ASP ASP A . n A 1 8 THR 8 211 211 THR THR A . n A 1 9 THR 9 212 212 THR THR A . n A 1 10 VAL 10 213 213 VAL VAL A . n A 1 11 TRP 11 214 214 TRP TRP A . n A 1 12 ILE 12 215 215 ILE ILE A . n A 1 13 SER 13 216 216 SER SER A . n A 1 14 VAL 14 217 217 VAL VAL A . n A 1 15 ALA 15 218 218 ALA ALA A . n A 1 16 VAL 16 219 219 VAL VAL A . n A 1 17 LEU 17 220 220 LEU LEU A . n A 1 18 SER 18 221 221 SER SER A . n A 1 19 ALA 19 222 222 ALA ALA A . n A 1 20 VAL 20 223 223 VAL VAL A . n A 1 21 ILE 21 224 224 ILE ILE A . n A 1 22 CYS 22 225 225 CYS CYS A . n A 1 23 LEU 23 226 226 LEU LEU A . n A 1 24 ILE 24 227 227 ILE ILE A . n A 1 25 ILE 25 228 228 ILE ILE A . n A 1 26 VAL 26 229 229 VAL VAL A . n A 1 27 TRP 27 230 230 TRP TRP A . n A 1 28 ALA 28 231 231 ALA ALA A . n A 1 29 VAL 29 232 232 VAL VAL A . n A 1 30 ALA 30 233 233 ALA ALA A . n A 1 31 LEU 31 234 234 LEU LEU A . n A 1 32 LYS 32 235 235 LYS LYS A . n A 1 33 GLY 33 236 236 GLY GLY A . n A 1 34 TYR 34 237 237 TYR TYR A . n A 1 35 SER 35 238 238 SER SER A . n A 1 36 MET 36 239 239 MET MET A . n A 1 37 VAL 37 240 240 VAL VAL A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N7I _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N7I _struct.title 'NMR structure of the prolactin receptor transmembrane domain' _struct.pdbx_model_details 'lowest energy, model6' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N7I _struct_keywords.pdbx_keywords 'HORMONE RECEPTOR' _struct_keywords.text 'transmembrane domain, membrane protein, receptor, HORMONE RECEPTOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRLR_HUMAN _struct_ref.pdbx_db_accession P16471 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code FTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMV _struct_ref.pdbx_align_begin 230 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N7I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 37 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16471 _struct_ref_seq.db_align_beg 230 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 264 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 206 _struct_ref_seq.pdbx_auth_seq_align_end 240 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N7I GLY A 1 ? UNP P16471 ? ? 'expression tag' 204 1 1 2N7I SER A 2 ? UNP P16471 ? ? 'expression tag' 205 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 6 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 28 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 209 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 231 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 206 ? ? 60.87 101.08 2 1 ASN A 209 ? ? -79.84 -155.57 3 1 SER A 238 ? ? -159.31 -65.84 4 2 THR A 207 ? ? 58.56 95.60 5 2 ASN A 209 ? ? -165.35 -67.38 6 2 SER A 238 ? ? -155.46 -73.23 7 3 THR A 207 ? ? -123.07 -69.34 8 3 MET A 208 ? ? -145.47 -71.86 9 3 ASN A 209 ? ? -171.95 -82.87 10 4 ASP A 210 ? ? -67.90 86.61 11 4 THR A 211 ? ? -97.45 -64.11 12 4 MET A 239 ? ? -103.10 40.46 13 5 THR A 207 ? ? 59.65 -90.33 14 5 MET A 239 ? ? -94.13 35.65 15 7 PHE A 206 ? ? -151.53 13.56 16 7 ASN A 209 ? ? -55.19 -74.30 17 7 ASP A 210 ? ? -169.70 6.71 18 8 SER A 205 ? ? 61.12 -84.28 19 8 THR A 207 ? ? -154.67 -66.59 20 8 MET A 208 ? ? 64.18 118.40 21 8 ASP A 210 ? ? -176.21 7.50 22 9 MET A 208 ? ? 63.07 -82.21 23 9 ASP A 210 ? ? -167.28 12.46 24 9 TYR A 237 ? ? 34.21 35.30 25 10 SER A 205 ? ? -132.19 -58.98 26 10 PHE A 206 ? ? 55.02 81.37 27 10 THR A 207 ? ? -108.63 47.90 28 10 MET A 208 ? ? -155.62 -51.11 29 10 LYS A 235 ? ? -114.06 50.26 30 10 MET A 239 ? ? -86.66 32.38 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N7I _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N7I _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.8 mM [U-13C; U-15N] PRLRTMD, 2 mM DSS, 0.05 % sodium azide, 560 mM DHPC, 20 mM sodium phosphate, 4 mM TCEP, 50 mM sodium chloride, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;1 mM [U-13C; U-15N] PRLRTMD, 2 mM DSS, 0.05 % sodium azide, 700 mM [U-2H] DHPC, 20 mM sodium phosphate, 4 mM TCEP, 50 mM sodium chloride, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;0.7 mM [U-15N] PRLRTMD, 2 mM DSS, 0.05 % sodium azide, 490 mM DHPC, 20 mM sodium phosphate, 4 mM TCEP, 50 mM sodium chloride, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id PRLRTMD-1 0.8 ? mM '[U-13C; U-15N]' 1 DSS-2 2 ? mM ? 1 'sodium azide-3' 0.05 ? % ? 1 DHPC-4 560 ? mM ? 1 'sodium phosphate-5' 20 ? mM ? 1 TCEP-6 4 ? mM ? 1 'sodium chloride-7' 50 ? mM ? 1 PRLRTMD-8 1 ? mM '[U-13C; U-15N]' 2 DSS-9 2 ? mM ? 2 'sodium azide-10' 0.05 ? % ? 2 DHPC-11 700 ? mM '[U-2H]' 2 'sodium phosphate-12' 20 ? mM ? 2 TCEP-13 4 ? mM ? 2 'sodium chloride-14' 50 ? mM ? 2 PRLRTMD-15 0.7 ? mM '[U-15N]' 3 DSS-16 2 ? mM ? 3 'sodium azide-17' 0.05 ? % ? 3 DHPC-18 490 ? mM ? 3 'sodium phosphate-19' 20 ? mM ? 3 TCEP-20 4 ? mM ? 3 'sodium chloride-21' 50 ? mM ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-15N HSQC' 1 2 3 '3D HNHA' 1 3 3 '2D 1H-15N HSQC' 1 4 1 '2D 1H-15N HSQC' 1 5 2 '2D 1H-15N HSQC' 1 6 1 '3D HNCO' 1 7 1 '3D HNCACB' 1 8 1 '3D CBCA(CO)NH' 1 9 2 '3D 1H-15N NOESY' 1 10 2 '2D 1H-13C HSQC aliphatic' 1 11 2 '2D 1H-13C HSQC aromatic' # _pdbx_nmr_refine.entry_id 2N7I _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.3.2 1 ;Linge, O'Donoghue and Nilges ; refinement ARIA 2.3.2 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLY N N N N 61 GLY CA C N N 62 GLY C C N N 63 GLY O O N N 64 GLY OXT O N N 65 GLY H H N N 66 GLY H2 H N N 67 GLY HA2 H N N 68 GLY HA3 H N N 69 GLY HXT H N N 70 ILE N N N N 71 ILE CA C N S 72 ILE C C N N 73 ILE O O N N 74 ILE CB C N S 75 ILE CG1 C N N 76 ILE CG2 C N N 77 ILE CD1 C N N 78 ILE OXT O N N 79 ILE H H N N 80 ILE H2 H N N 81 ILE HA H N N 82 ILE HB H N N 83 ILE HG12 H N N 84 ILE HG13 H N N 85 ILE HG21 H N N 86 ILE HG22 H N N 87 ILE HG23 H N N 88 ILE HD11 H N N 89 ILE HD12 H N N 90 ILE HD13 H N N 91 ILE HXT H N N 92 LEU N N N N 93 LEU CA C N S 94 LEU C C N N 95 LEU O O N N 96 LEU CB C N N 97 LEU CG C N N 98 LEU CD1 C N N 99 LEU CD2 C N N 100 LEU OXT O N N 101 LEU H H N N 102 LEU H2 H N N 103 LEU HA H N N 104 LEU HB2 H N N 105 LEU HB3 H N N 106 LEU HG H N N 107 LEU HD11 H N N 108 LEU HD12 H N N 109 LEU HD13 H N N 110 LEU HD21 H N N 111 LEU HD22 H N N 112 LEU HD23 H N N 113 LEU HXT H N N 114 LYS N N N N 115 LYS CA C N S 116 LYS C C N N 117 LYS O O N N 118 LYS CB C N N 119 LYS CG C N N 120 LYS CD C N N 121 LYS CE C N N 122 LYS NZ N N N 123 LYS OXT O N N 124 LYS H H N N 125 LYS H2 H N N 126 LYS HA H N N 127 LYS HB2 H N N 128 LYS HB3 H N N 129 LYS HG2 H N N 130 LYS HG3 H N N 131 LYS HD2 H N N 132 LYS HD3 H N N 133 LYS HE2 H N N 134 LYS HE3 H N N 135 LYS HZ1 H N N 136 LYS HZ2 H N N 137 LYS HZ3 H N N 138 LYS HXT H N N 139 MET N N N N 140 MET CA C N S 141 MET C C N N 142 MET O O N N 143 MET CB C N N 144 MET CG C N N 145 MET SD S N N 146 MET CE C N N 147 MET OXT O N N 148 MET H H N N 149 MET H2 H N N 150 MET HA H N N 151 MET HB2 H N N 152 MET HB3 H N N 153 MET HG2 H N N 154 MET HG3 H N N 155 MET HE1 H N N 156 MET HE2 H N N 157 MET HE3 H N N 158 MET HXT H N N 159 PHE N N N N 160 PHE CA C N S 161 PHE C C N N 162 PHE O O N N 163 PHE CB C N N 164 PHE CG C Y N 165 PHE CD1 C Y N 166 PHE CD2 C Y N 167 PHE CE1 C Y N 168 PHE CE2 C Y N 169 PHE CZ C Y N 170 PHE OXT O N N 171 PHE H H N N 172 PHE H2 H N N 173 PHE HA H N N 174 PHE HB2 H N N 175 PHE HB3 H N N 176 PHE HD1 H N N 177 PHE HD2 H N N 178 PHE HE1 H N N 179 PHE HE2 H N N 180 PHE HZ H N N 181 PHE HXT H N N 182 SER N N N N 183 SER CA C N S 184 SER C C N N 185 SER O O N N 186 SER CB C N N 187 SER OG O N N 188 SER OXT O N N 189 SER H H N N 190 SER H2 H N N 191 SER HA H N N 192 SER HB2 H N N 193 SER HB3 H N N 194 SER HG H N N 195 SER HXT H N N 196 THR N N N N 197 THR CA C N S 198 THR C C N N 199 THR O O N N 200 THR CB C N R 201 THR OG1 O N N 202 THR CG2 C N N 203 THR OXT O N N 204 THR H H N N 205 THR H2 H N N 206 THR HA H N N 207 THR HB H N N 208 THR HG1 H N N 209 THR HG21 H N N 210 THR HG22 H N N 211 THR HG23 H N N 212 THR HXT H N N 213 TRP N N N N 214 TRP CA C N S 215 TRP C C N N 216 TRP O O N N 217 TRP CB C N N 218 TRP CG C Y N 219 TRP CD1 C Y N 220 TRP CD2 C Y N 221 TRP NE1 N Y N 222 TRP CE2 C Y N 223 TRP CE3 C Y N 224 TRP CZ2 C Y N 225 TRP CZ3 C Y N 226 TRP CH2 C Y N 227 TRP OXT O N N 228 TRP H H N N 229 TRP H2 H N N 230 TRP HA H N N 231 TRP HB2 H N N 232 TRP HB3 H N N 233 TRP HD1 H N N 234 TRP HE1 H N N 235 TRP HE3 H N N 236 TRP HZ2 H N N 237 TRP HZ3 H N N 238 TRP HH2 H N N 239 TRP HXT H N N 240 TYR N N N N 241 TYR CA C N S 242 TYR C C N N 243 TYR O O N N 244 TYR CB C N N 245 TYR CG C Y N 246 TYR CD1 C Y N 247 TYR CD2 C Y N 248 TYR CE1 C Y N 249 TYR CE2 C Y N 250 TYR CZ C Y N 251 TYR OH O N N 252 TYR OXT O N N 253 TYR H H N N 254 TYR H2 H N N 255 TYR HA H N N 256 TYR HB2 H N N 257 TYR HB3 H N N 258 TYR HD1 H N N 259 TYR HD2 H N N 260 TYR HE1 H N N 261 TYR HE2 H N N 262 TYR HH H N N 263 TYR HXT H N N 264 VAL N N N N 265 VAL CA C N S 266 VAL C C N N 267 VAL O O N N 268 VAL CB C N N 269 VAL CG1 C N N 270 VAL CG2 C N N 271 VAL OXT O N N 272 VAL H H N N 273 VAL H2 H N N 274 VAL HA H N N 275 VAL HB H N N 276 VAL HG11 H N N 277 VAL HG12 H N N 278 VAL HG13 H N N 279 VAL HG21 H N N 280 VAL HG22 H N N 281 VAL HG23 H N N 282 VAL HXT H N N 283 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLY N CA sing N N 57 GLY N H sing N N 58 GLY N H2 sing N N 59 GLY CA C sing N N 60 GLY CA HA2 sing N N 61 GLY CA HA3 sing N N 62 GLY C O doub N N 63 GLY C OXT sing N N 64 GLY OXT HXT sing N N 65 ILE N CA sing N N 66 ILE N H sing N N 67 ILE N H2 sing N N 68 ILE CA C sing N N 69 ILE CA CB sing N N 70 ILE CA HA sing N N 71 ILE C O doub N N 72 ILE C OXT sing N N 73 ILE CB CG1 sing N N 74 ILE CB CG2 sing N N 75 ILE CB HB sing N N 76 ILE CG1 CD1 sing N N 77 ILE CG1 HG12 sing N N 78 ILE CG1 HG13 sing N N 79 ILE CG2 HG21 sing N N 80 ILE CG2 HG22 sing N N 81 ILE CG2 HG23 sing N N 82 ILE CD1 HD11 sing N N 83 ILE CD1 HD12 sing N N 84 ILE CD1 HD13 sing N N 85 ILE OXT HXT sing N N 86 LEU N CA sing N N 87 LEU N H sing N N 88 LEU N H2 sing N N 89 LEU CA C sing N N 90 LEU CA CB sing N N 91 LEU CA HA sing N N 92 LEU C O doub N N 93 LEU C OXT sing N N 94 LEU CB CG sing N N 95 LEU CB HB2 sing N N 96 LEU CB HB3 sing N N 97 LEU CG CD1 sing N N 98 LEU CG CD2 sing N N 99 LEU CG HG sing N N 100 LEU CD1 HD11 sing N N 101 LEU CD1 HD12 sing N N 102 LEU CD1 HD13 sing N N 103 LEU CD2 HD21 sing N N 104 LEU CD2 HD22 sing N N 105 LEU CD2 HD23 sing N N 106 LEU OXT HXT sing N N 107 LYS N CA sing N N 108 LYS N H sing N N 109 LYS N H2 sing N N 110 LYS CA C sing N N 111 LYS CA CB sing N N 112 LYS CA HA sing N N 113 LYS C O doub N N 114 LYS C OXT sing N N 115 LYS CB CG sing N N 116 LYS CB HB2 sing N N 117 LYS CB HB3 sing N N 118 LYS CG CD sing N N 119 LYS CG HG2 sing N N 120 LYS CG HG3 sing N N 121 LYS CD CE sing N N 122 LYS CD HD2 sing N N 123 LYS CD HD3 sing N N 124 LYS CE NZ sing N N 125 LYS CE HE2 sing N N 126 LYS CE HE3 sing N N 127 LYS NZ HZ1 sing N N 128 LYS NZ HZ2 sing N N 129 LYS NZ HZ3 sing N N 130 LYS OXT HXT sing N N 131 MET N CA sing N N 132 MET N H sing N N 133 MET N H2 sing N N 134 MET CA C sing N N 135 MET CA CB sing N N 136 MET CA HA sing N N 137 MET C O doub N N 138 MET C OXT sing N N 139 MET CB CG sing N N 140 MET CB HB2 sing N N 141 MET CB HB3 sing N N 142 MET CG SD sing N N 143 MET CG HG2 sing N N 144 MET CG HG3 sing N N 145 MET SD CE sing N N 146 MET CE HE1 sing N N 147 MET CE HE2 sing N N 148 MET CE HE3 sing N N 149 MET OXT HXT sing N N 150 PHE N CA sing N N 151 PHE N H sing N N 152 PHE N H2 sing N N 153 PHE CA C sing N N 154 PHE CA CB sing N N 155 PHE CA HA sing N N 156 PHE C O doub N N 157 PHE C OXT sing N N 158 PHE CB CG sing N N 159 PHE CB HB2 sing N N 160 PHE CB HB3 sing N N 161 PHE CG CD1 doub Y N 162 PHE CG CD2 sing Y N 163 PHE CD1 CE1 sing Y N 164 PHE CD1 HD1 sing N N 165 PHE CD2 CE2 doub Y N 166 PHE CD2 HD2 sing N N 167 PHE CE1 CZ doub Y N 168 PHE CE1 HE1 sing N N 169 PHE CE2 CZ sing Y N 170 PHE CE2 HE2 sing N N 171 PHE CZ HZ sing N N 172 PHE OXT HXT sing N N 173 SER N CA sing N N 174 SER N H sing N N 175 SER N H2 sing N N 176 SER CA C sing N N 177 SER CA CB sing N N 178 SER CA HA sing N N 179 SER C O doub N N 180 SER C OXT sing N N 181 SER CB OG sing N N 182 SER CB HB2 sing N N 183 SER CB HB3 sing N N 184 SER OG HG sing N N 185 SER OXT HXT sing N N 186 THR N CA sing N N 187 THR N H sing N N 188 THR N H2 sing N N 189 THR CA C sing N N 190 THR CA CB sing N N 191 THR CA HA sing N N 192 THR C O doub N N 193 THR C OXT sing N N 194 THR CB OG1 sing N N 195 THR CB CG2 sing N N 196 THR CB HB sing N N 197 THR OG1 HG1 sing N N 198 THR CG2 HG21 sing N N 199 THR CG2 HG22 sing N N 200 THR CG2 HG23 sing N N 201 THR OXT HXT sing N N 202 TRP N CA sing N N 203 TRP N H sing N N 204 TRP N H2 sing N N 205 TRP CA C sing N N 206 TRP CA CB sing N N 207 TRP CA HA sing N N 208 TRP C O doub N N 209 TRP C OXT sing N N 210 TRP CB CG sing N N 211 TRP CB HB2 sing N N 212 TRP CB HB3 sing N N 213 TRP CG CD1 doub Y N 214 TRP CG CD2 sing Y N 215 TRP CD1 NE1 sing Y N 216 TRP CD1 HD1 sing N N 217 TRP CD2 CE2 doub Y N 218 TRP CD2 CE3 sing Y N 219 TRP NE1 CE2 sing Y N 220 TRP NE1 HE1 sing N N 221 TRP CE2 CZ2 sing Y N 222 TRP CE3 CZ3 doub Y N 223 TRP CE3 HE3 sing N N 224 TRP CZ2 CH2 doub Y N 225 TRP CZ2 HZ2 sing N N 226 TRP CZ3 CH2 sing Y N 227 TRP CZ3 HZ3 sing N N 228 TRP CH2 HH2 sing N N 229 TRP OXT HXT sing N N 230 TYR N CA sing N N 231 TYR N H sing N N 232 TYR N H2 sing N N 233 TYR CA C sing N N 234 TYR CA CB sing N N 235 TYR CA HA sing N N 236 TYR C O doub N N 237 TYR C OXT sing N N 238 TYR CB CG sing N N 239 TYR CB HB2 sing N N 240 TYR CB HB3 sing N N 241 TYR CG CD1 doub Y N 242 TYR CG CD2 sing Y N 243 TYR CD1 CE1 sing Y N 244 TYR CD1 HD1 sing N N 245 TYR CD2 CE2 doub Y N 246 TYR CD2 HD2 sing N N 247 TYR CE1 CZ doub Y N 248 TYR CE1 HE1 sing N N 249 TYR CE2 CZ sing Y N 250 TYR CE2 HE2 sing N N 251 TYR CZ OH sing N N 252 TYR OH HH sing N N 253 TYR OXT HXT sing N N 254 VAL N CA sing N N 255 VAL N H sing N N 256 VAL N H2 sing N N 257 VAL CA C sing N N 258 VAL CA CB sing N N 259 VAL CA HA sing N N 260 VAL C O doub N N 261 VAL C OXT sing N N 262 VAL CB CG1 sing N N 263 VAL CB CG2 sing N N 264 VAL CB HB sing N N 265 VAL CG1 HG11 sing N N 266 VAL CG1 HG12 sing N N 267 VAL CG1 HG13 sing N N 268 VAL CG2 HG21 sing N N 269 VAL CG2 HG22 sing N N 270 VAL CG2 HG23 sing N N 271 VAL OXT HXT sing N N 272 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 750 Varian INOVA 2 'Varian INOVA' 900 Bruker AVANCE 3 'Bruker Avance' # _atom_sites.entry_id 2N7I _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #