data_2N7R # _entry.id 2N7R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104528 RCSB ? ? 2N7R PDB pdb_00002n7r 10.2210/pdb2n7r/pdb 25818 BMRB ? 10.13018/BMR25818 D_1000104528 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-04-27 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_spectrometer.model' 4 2 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N7R _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2015-09-17 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25818 BMRB unspecified . 2N7Q PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, Y.' 1 'Liew, L.' 2 'Li, Q.' 3 'Kang, C.' 4 # _citation.id primary _citation.title 'Structure of the transmembrane domain of human nicastrin-a component of gamma-secretase' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 6 _citation.page_first 19522 _citation.page_last 19522 _citation.year 2016 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26776682 _citation.pdbx_database_id_DOI 10.1038/srep19522 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, Y.' 1 ? primary 'Liew, L.S.' 2 ? primary 'Li, Q.' 3 ? primary 'Kang, C.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Nicastrin _entity.formula_weight 5992.000 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 664-709' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MAHHHHHHASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY _entity_poly.pdbx_seq_one_letter_code_can MAHHHHHHASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 ALA n 1 10 SER n 1 11 LYS n 1 12 GLU n 1 13 LEU n 1 14 GLU n 1 15 LEU n 1 16 ILE n 1 17 THR n 1 18 LEU n 1 19 THR n 1 20 VAL n 1 21 GLY n 1 22 PHE n 1 23 GLY n 1 24 ILE n 1 25 LEU n 1 26 ILE n 1 27 PHE n 1 28 SER n 1 29 LEU n 1 30 ILE n 1 31 VAL n 1 32 THR n 1 33 TYR n 1 34 CYS n 1 35 ILE n 1 36 ASN n 1 37 ALA n 1 38 LYS n 1 39 ALA n 1 40 ASP n 1 41 VAL n 1 42 LEU n 1 43 PHE n 1 44 ILE n 1 45 ALA n 1 46 PRO n 1 47 ARG n 1 48 GLU n 1 49 PRO n 1 50 GLY n 1 51 ALA n 1 52 VAL n 1 53 SER n 1 54 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET29b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -7 ? ? ? A . n A 1 2 ALA 2 -6 ? ? ? A . n A 1 3 HIS 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 HIS 5 -3 ? ? ? A . n A 1 6 HIS 6 -2 ? ? ? A . n A 1 7 HIS 7 -1 ? ? ? A . n A 1 8 HIS 8 0 ? ? ? A . n A 1 9 ALA 9 1 1 ALA ALA A . n A 1 10 SER 10 2 2 SER SER A . n A 1 11 LYS 11 3 3 LYS LYS A . n A 1 12 GLU 12 4 4 GLU GLU A . n A 1 13 LEU 13 5 5 LEU LEU A . n A 1 14 GLU 14 6 6 GLU GLU A . n A 1 15 LEU 15 7 7 LEU LEU A . n A 1 16 ILE 16 8 8 ILE ILE A . n A 1 17 THR 17 9 9 THR THR A . n A 1 18 LEU 18 10 10 LEU LEU A . n A 1 19 THR 19 11 11 THR THR A . n A 1 20 VAL 20 12 12 VAL VAL A . n A 1 21 GLY 21 13 13 GLY GLY A . n A 1 22 PHE 22 14 14 PHE PHE A . n A 1 23 GLY 23 15 15 GLY GLY A . n A 1 24 ILE 24 16 16 ILE ILE A . n A 1 25 LEU 25 17 17 LEU LEU A . n A 1 26 ILE 26 18 18 ILE ILE A . n A 1 27 PHE 27 19 19 PHE PHE A . n A 1 28 SER 28 20 20 SER SER A . n A 1 29 LEU 29 21 21 LEU LEU A . n A 1 30 ILE 30 22 22 ILE ILE A . n A 1 31 VAL 31 23 23 VAL VAL A . n A 1 32 THR 32 24 24 THR THR A . n A 1 33 TYR 33 25 25 TYR TYR A . n A 1 34 CYS 34 26 26 CYS CYS A . n A 1 35 ILE 35 27 27 ILE ILE A . n A 1 36 ASN 36 28 28 ASN ASN A . n A 1 37 ALA 37 29 29 ALA ALA A . n A 1 38 LYS 38 30 30 LYS LYS A . n A 1 39 ALA 39 31 31 ALA ALA A . n A 1 40 ASP 40 32 32 ASP ASP A . n A 1 41 VAL 41 33 33 VAL VAL A . n A 1 42 LEU 42 34 34 LEU LEU A . n A 1 43 PHE 43 35 35 PHE PHE A . n A 1 44 ILE 44 36 36 ILE ILE A . n A 1 45 ALA 45 37 37 ALA ALA A . n A 1 46 PRO 46 38 38 PRO PRO A . n A 1 47 ARG 47 39 39 ARG ARG A . n A 1 48 GLU 48 40 40 GLU GLU A . n A 1 49 PRO 49 41 41 PRO PRO A . n A 1 50 GLY 50 42 42 GLY GLY A . n A 1 51 ALA 51 43 43 ALA ALA A . n A 1 52 VAL 52 44 44 VAL VAL A . n A 1 53 SER 53 45 45 SER SER A . n A 1 54 TYR 54 46 46 TYR TYR A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N7R _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N7R _struct.title 'Structure of the transmembrane domain of human nicastrin in DPC micelles' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N7R _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'Detergent micelles, gamma-secretase, nicastrin, MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NICA_HUMAN _struct_ref.pdbx_db_accession Q92542 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY _struct_ref.pdbx_align_begin 664 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N7R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q92542 _struct_ref_seq.db_align_beg 664 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 709 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 46 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N7R MET A 1 ? UNP Q92542 ? ? 'expression tag' -7 1 1 2N7R ALA A 2 ? UNP Q92542 ? ? 'expression tag' -6 2 1 2N7R HIS A 3 ? UNP Q92542 ? ? 'expression tag' -5 3 1 2N7R HIS A 4 ? UNP Q92542 ? ? 'expression tag' -4 4 1 2N7R HIS A 5 ? UNP Q92542 ? ? 'expression tag' -3 5 1 2N7R HIS A 6 ? UNP Q92542 ? ? 'expression tag' -2 6 1 2N7R HIS A 7 ? UNP Q92542 ? ? 'expression tag' -1 7 1 2N7R HIS A 8 ? UNP Q92542 ? ? 'expression tag' 0 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 9 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 41 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 1 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 33 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 33 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 11 _pdbx_validate_close_contact.auth_atom_id_1 H _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ALA _pdbx_validate_close_contact.auth_seq_id_1 1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 2 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.28 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 35 ? ? -79.98 26.70 2 1 ILE A 36 ? ? -38.97 -92.96 3 2 VAL A 33 ? ? -56.72 -6.91 4 2 ILE A 36 ? ? -108.50 -113.55 5 2 PRO A 38 ? ? -70.17 -167.57 6 2 PRO A 41 ? ? -68.86 22.17 7 2 ALA A 43 ? ? 178.29 2.89 8 3 ILE A 36 ? ? -111.46 -123.15 9 3 ALA A 37 ? ? -49.03 161.14 10 4 ILE A 36 ? ? -104.49 -115.94 11 4 ALA A 37 ? ? -48.02 162.07 12 4 PRO A 38 ? ? -39.79 161.48 13 4 ALA A 43 ? ? -100.92 -108.33 14 5 ILE A 36 ? ? -102.17 -121.59 15 5 ALA A 37 ? ? -48.41 161.17 16 5 PRO A 38 ? ? -39.74 153.11 17 5 VAL A 44 ? ? 114.88 120.92 18 6 ILE A 36 ? ? -38.05 -93.33 19 6 PRO A 41 ? ? -38.69 120.19 20 7 SER A 2 ? ? 72.91 -2.30 21 7 ILE A 36 ? ? -102.58 -76.70 22 7 PRO A 38 ? ? -38.53 162.61 23 8 PHE A 35 ? ? -79.46 31.59 24 8 ILE A 36 ? ? -39.73 -91.52 25 8 PRO A 38 ? ? -41.63 156.29 26 8 ALA A 43 ? ? -170.45 27.56 27 9 PHE A 35 ? ? -79.63 29.58 28 9 ILE A 36 ? ? -40.60 -93.25 29 9 ALA A 43 ? ? -41.65 105.63 30 10 ILE A 36 ? ? -96.70 -71.84 31 10 PRO A 38 ? ? -68.11 -168.81 32 10 PRO A 41 ? ? -39.19 111.03 33 10 SER A 45 ? ? -59.58 109.17 34 11 ILE A 36 ? ? 59.05 -68.45 35 11 ALA A 43 ? ? 48.68 15.17 36 12 SER A 2 ? ? -38.15 -32.53 37 12 ILE A 36 ? ? -92.35 -76.29 38 12 PRO A 38 ? ? -39.80 148.24 39 13 SER A 2 ? ? -58.51 -2.13 40 13 PHE A 35 ? ? -83.61 31.90 41 13 ILE A 36 ? ? -36.75 -88.66 42 13 PRO A 41 ? ? -39.12 138.61 43 14 SER A 2 ? ? 47.22 19.45 44 14 ILE A 36 ? ? -100.78 -74.78 45 14 PRO A 41 ? ? -68.61 3.19 46 14 ALA A 43 ? ? 63.78 175.32 47 14 VAL A 44 ? ? -49.87 98.61 48 15 PHE A 35 ? ? -80.80 30.61 49 15 ILE A 36 ? ? -35.59 -90.96 50 15 ALA A 43 ? ? 61.58 123.98 51 16 ILE A 36 ? ? 56.67 -72.09 52 16 PRO A 38 ? ? -67.82 -167.02 53 17 SER A 2 ? ? 75.40 -55.29 54 17 VAL A 33 ? ? -51.59 -7.40 55 17 ILE A 36 ? ? -116.01 -118.63 56 17 PRO A 38 ? ? -39.86 153.02 57 17 ALA A 43 ? ? 59.52 18.95 58 17 SER A 45 ? ? -41.97 151.09 59 18 SER A 2 ? ? -59.51 -2.98 60 18 ILE A 36 ? ? -93.89 -74.52 61 18 PRO A 38 ? ? -39.32 145.71 62 18 PRO A 41 ? ? -64.69 -179.77 63 18 ALA A 43 ? ? 42.71 94.90 64 18 SER A 45 ? ? 41.19 94.56 65 19 PHE A 35 ? ? -83.35 30.10 66 19 ILE A 36 ? ? -40.59 -88.91 67 19 SER A 45 ? ? -47.81 156.82 68 20 ALA A 43 ? ? 60.78 106.69 69 20 VAL A 44 ? ? 115.48 102.43 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N7R _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N7R _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents ;0.8 mM [U-100% 13C; U-100% 15N] transmembrane domain of human nicastrin-1, 20 mM sodium phosphate-2, 200 mM DPC-3, 1 mM DTT-4, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'transmembrane domain of human nicastrin-1' 0.8 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 DPC-3 200 ? mM ? 1 DTT-4 1 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCA' 1 3 1 '3D HNCACB' 1 4 1 '3D HN(COCA)CB' 1 5 1 '3D HNCO' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D HBHA(CO)NH' # _pdbx_nmr_refine.entry_id 2N7R _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;simulation annealing was conducted. Totally 56 structures were calculated and 20 of them were selected. structures were then energy minimized. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 1 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'chemical shift assignment' NMRPipe 2 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'structure solution' NMRPipe 3 ? 'Schwieters, Clore' refinement XPLORE-NIH 4 ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -7 ? A MET 1 2 1 Y 1 A ALA -6 ? A ALA 2 3 1 Y 1 A HIS -5 ? A HIS 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A HIS -3 ? A HIS 5 6 1 Y 1 A HIS -2 ? A HIS 6 7 1 Y 1 A HIS -1 ? A HIS 7 8 1 Y 1 A HIS 0 ? A HIS 8 9 2 Y 1 A MET -7 ? A MET 1 10 2 Y 1 A ALA -6 ? A ALA 2 11 2 Y 1 A HIS -5 ? A HIS 3 12 2 Y 1 A HIS -4 ? A HIS 4 13 2 Y 1 A HIS -3 ? A HIS 5 14 2 Y 1 A HIS -2 ? A HIS 6 15 2 Y 1 A HIS -1 ? A HIS 7 16 2 Y 1 A HIS 0 ? A HIS 8 17 3 Y 1 A MET -7 ? A MET 1 18 3 Y 1 A ALA -6 ? A ALA 2 19 3 Y 1 A HIS -5 ? A HIS 3 20 3 Y 1 A HIS -4 ? A HIS 4 21 3 Y 1 A HIS -3 ? A HIS 5 22 3 Y 1 A HIS -2 ? A HIS 6 23 3 Y 1 A HIS -1 ? A HIS 7 24 3 Y 1 A HIS 0 ? A HIS 8 25 4 Y 1 A MET -7 ? A MET 1 26 4 Y 1 A ALA -6 ? A ALA 2 27 4 Y 1 A HIS -5 ? A HIS 3 28 4 Y 1 A HIS -4 ? A HIS 4 29 4 Y 1 A HIS -3 ? A HIS 5 30 4 Y 1 A HIS -2 ? A HIS 6 31 4 Y 1 A HIS -1 ? A HIS 7 32 4 Y 1 A HIS 0 ? A HIS 8 33 5 Y 1 A MET -7 ? A MET 1 34 5 Y 1 A ALA -6 ? A ALA 2 35 5 Y 1 A HIS -5 ? A HIS 3 36 5 Y 1 A HIS -4 ? A HIS 4 37 5 Y 1 A HIS -3 ? A HIS 5 38 5 Y 1 A HIS -2 ? A HIS 6 39 5 Y 1 A HIS -1 ? A HIS 7 40 5 Y 1 A HIS 0 ? A HIS 8 41 6 Y 1 A MET -7 ? A MET 1 42 6 Y 1 A ALA -6 ? A ALA 2 43 6 Y 1 A HIS -5 ? A HIS 3 44 6 Y 1 A HIS -4 ? A HIS 4 45 6 Y 1 A HIS -3 ? A HIS 5 46 6 Y 1 A HIS -2 ? A HIS 6 47 6 Y 1 A HIS -1 ? A HIS 7 48 6 Y 1 A HIS 0 ? A HIS 8 49 7 Y 1 A MET -7 ? A MET 1 50 7 Y 1 A ALA -6 ? A ALA 2 51 7 Y 1 A HIS -5 ? A HIS 3 52 7 Y 1 A HIS -4 ? A HIS 4 53 7 Y 1 A HIS -3 ? A HIS 5 54 7 Y 1 A HIS -2 ? A HIS 6 55 7 Y 1 A HIS -1 ? A HIS 7 56 7 Y 1 A HIS 0 ? A HIS 8 57 8 Y 1 A MET -7 ? A MET 1 58 8 Y 1 A ALA -6 ? A ALA 2 59 8 Y 1 A HIS -5 ? A HIS 3 60 8 Y 1 A HIS -4 ? A HIS 4 61 8 Y 1 A HIS -3 ? A HIS 5 62 8 Y 1 A HIS -2 ? A HIS 6 63 8 Y 1 A HIS -1 ? A HIS 7 64 8 Y 1 A HIS 0 ? A HIS 8 65 9 Y 1 A MET -7 ? A MET 1 66 9 Y 1 A ALA -6 ? A ALA 2 67 9 Y 1 A HIS -5 ? A HIS 3 68 9 Y 1 A HIS -4 ? A HIS 4 69 9 Y 1 A HIS -3 ? A HIS 5 70 9 Y 1 A HIS -2 ? A HIS 6 71 9 Y 1 A HIS -1 ? A HIS 7 72 9 Y 1 A HIS 0 ? A HIS 8 73 10 Y 1 A MET -7 ? A MET 1 74 10 Y 1 A ALA -6 ? A ALA 2 75 10 Y 1 A HIS -5 ? A HIS 3 76 10 Y 1 A HIS -4 ? A HIS 4 77 10 Y 1 A HIS -3 ? A HIS 5 78 10 Y 1 A HIS -2 ? A HIS 6 79 10 Y 1 A HIS -1 ? A HIS 7 80 10 Y 1 A HIS 0 ? A HIS 8 81 11 Y 1 A MET -7 ? A MET 1 82 11 Y 1 A ALA -6 ? A ALA 2 83 11 Y 1 A HIS -5 ? A HIS 3 84 11 Y 1 A HIS -4 ? A HIS 4 85 11 Y 1 A HIS -3 ? A HIS 5 86 11 Y 1 A HIS -2 ? A HIS 6 87 11 Y 1 A HIS -1 ? A HIS 7 88 11 Y 1 A HIS 0 ? A HIS 8 89 12 Y 1 A MET -7 ? A MET 1 90 12 Y 1 A ALA -6 ? A ALA 2 91 12 Y 1 A HIS -5 ? A HIS 3 92 12 Y 1 A HIS -4 ? A HIS 4 93 12 Y 1 A HIS -3 ? A HIS 5 94 12 Y 1 A HIS -2 ? A HIS 6 95 12 Y 1 A HIS -1 ? A HIS 7 96 12 Y 1 A HIS 0 ? A HIS 8 97 13 Y 1 A MET -7 ? A MET 1 98 13 Y 1 A ALA -6 ? A ALA 2 99 13 Y 1 A HIS -5 ? A HIS 3 100 13 Y 1 A HIS -4 ? A HIS 4 101 13 Y 1 A HIS -3 ? A HIS 5 102 13 Y 1 A HIS -2 ? A HIS 6 103 13 Y 1 A HIS -1 ? A HIS 7 104 13 Y 1 A HIS 0 ? A HIS 8 105 14 Y 1 A MET -7 ? A MET 1 106 14 Y 1 A ALA -6 ? A ALA 2 107 14 Y 1 A HIS -5 ? A HIS 3 108 14 Y 1 A HIS -4 ? A HIS 4 109 14 Y 1 A HIS -3 ? A HIS 5 110 14 Y 1 A HIS -2 ? A HIS 6 111 14 Y 1 A HIS -1 ? A HIS 7 112 14 Y 1 A HIS 0 ? A HIS 8 113 15 Y 1 A MET -7 ? A MET 1 114 15 Y 1 A ALA -6 ? A ALA 2 115 15 Y 1 A HIS -5 ? A HIS 3 116 15 Y 1 A HIS -4 ? A HIS 4 117 15 Y 1 A HIS -3 ? A HIS 5 118 15 Y 1 A HIS -2 ? A HIS 6 119 15 Y 1 A HIS -1 ? A HIS 7 120 15 Y 1 A HIS 0 ? A HIS 8 121 16 Y 1 A MET -7 ? A MET 1 122 16 Y 1 A ALA -6 ? A ALA 2 123 16 Y 1 A HIS -5 ? A HIS 3 124 16 Y 1 A HIS -4 ? A HIS 4 125 16 Y 1 A HIS -3 ? A HIS 5 126 16 Y 1 A HIS -2 ? A HIS 6 127 16 Y 1 A HIS -1 ? A HIS 7 128 16 Y 1 A HIS 0 ? A HIS 8 129 17 Y 1 A MET -7 ? A MET 1 130 17 Y 1 A ALA -6 ? A ALA 2 131 17 Y 1 A HIS -5 ? A HIS 3 132 17 Y 1 A HIS -4 ? A HIS 4 133 17 Y 1 A HIS -3 ? A HIS 5 134 17 Y 1 A HIS -2 ? A HIS 6 135 17 Y 1 A HIS -1 ? A HIS 7 136 17 Y 1 A HIS 0 ? A HIS 8 137 18 Y 1 A MET -7 ? A MET 1 138 18 Y 1 A ALA -6 ? A ALA 2 139 18 Y 1 A HIS -5 ? A HIS 3 140 18 Y 1 A HIS -4 ? A HIS 4 141 18 Y 1 A HIS -3 ? A HIS 5 142 18 Y 1 A HIS -2 ? A HIS 6 143 18 Y 1 A HIS -1 ? A HIS 7 144 18 Y 1 A HIS 0 ? A HIS 8 145 19 Y 1 A MET -7 ? A MET 1 146 19 Y 1 A ALA -6 ? A ALA 2 147 19 Y 1 A HIS -5 ? A HIS 3 148 19 Y 1 A HIS -4 ? A HIS 4 149 19 Y 1 A HIS -3 ? A HIS 5 150 19 Y 1 A HIS -2 ? A HIS 6 151 19 Y 1 A HIS -1 ? A HIS 7 152 19 Y 1 A HIS 0 ? A HIS 8 153 20 Y 1 A MET -7 ? A MET 1 154 20 Y 1 A ALA -6 ? A ALA 2 155 20 Y 1 A HIS -5 ? A HIS 3 156 20 Y 1 A HIS -4 ? A HIS 4 157 20 Y 1 A HIS -3 ? A HIS 5 158 20 Y 1 A HIS -2 ? A HIS 6 159 20 Y 1 A HIS -1 ? A HIS 7 160 20 Y 1 A HIS 0 ? A HIS 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 HIS N N N N 117 HIS CA C N S 118 HIS C C N N 119 HIS O O N N 120 HIS CB C N N 121 HIS CG C Y N 122 HIS ND1 N Y N 123 HIS CD2 C Y N 124 HIS CE1 C Y N 125 HIS NE2 N Y N 126 HIS OXT O N N 127 HIS H H N N 128 HIS H2 H N N 129 HIS HA H N N 130 HIS HB2 H N N 131 HIS HB3 H N N 132 HIS HD1 H N N 133 HIS HD2 H N N 134 HIS HE1 H N N 135 HIS HE2 H N N 136 HIS HXT H N N 137 ILE N N N N 138 ILE CA C N S 139 ILE C C N N 140 ILE O O N N 141 ILE CB C N S 142 ILE CG1 C N N 143 ILE CG2 C N N 144 ILE CD1 C N N 145 ILE OXT O N N 146 ILE H H N N 147 ILE H2 H N N 148 ILE HA H N N 149 ILE HB H N N 150 ILE HG12 H N N 151 ILE HG13 H N N 152 ILE HG21 H N N 153 ILE HG22 H N N 154 ILE HG23 H N N 155 ILE HD11 H N N 156 ILE HD12 H N N 157 ILE HD13 H N N 158 ILE HXT H N N 159 LEU N N N N 160 LEU CA C N S 161 LEU C C N N 162 LEU O O N N 163 LEU CB C N N 164 LEU CG C N N 165 LEU CD1 C N N 166 LEU CD2 C N N 167 LEU OXT O N N 168 LEU H H N N 169 LEU H2 H N N 170 LEU HA H N N 171 LEU HB2 H N N 172 LEU HB3 H N N 173 LEU HG H N N 174 LEU HD11 H N N 175 LEU HD12 H N N 176 LEU HD13 H N N 177 LEU HD21 H N N 178 LEU HD22 H N N 179 LEU HD23 H N N 180 LEU HXT H N N 181 LYS N N N N 182 LYS CA C N S 183 LYS C C N N 184 LYS O O N N 185 LYS CB C N N 186 LYS CG C N N 187 LYS CD C N N 188 LYS CE C N N 189 LYS NZ N N N 190 LYS OXT O N N 191 LYS H H N N 192 LYS H2 H N N 193 LYS HA H N N 194 LYS HB2 H N N 195 LYS HB3 H N N 196 LYS HG2 H N N 197 LYS HG3 H N N 198 LYS HD2 H N N 199 LYS HD3 H N N 200 LYS HE2 H N N 201 LYS HE3 H N N 202 LYS HZ1 H N N 203 LYS HZ2 H N N 204 LYS HZ3 H N N 205 LYS HXT H N N 206 MET N N N N 207 MET CA C N S 208 MET C C N N 209 MET O O N N 210 MET CB C N N 211 MET CG C N N 212 MET SD S N N 213 MET CE C N N 214 MET OXT O N N 215 MET H H N N 216 MET H2 H N N 217 MET HA H N N 218 MET HB2 H N N 219 MET HB3 H N N 220 MET HG2 H N N 221 MET HG3 H N N 222 MET HE1 H N N 223 MET HE2 H N N 224 MET HE3 H N N 225 MET HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TYR N N N N 298 TYR CA C N S 299 TYR C C N N 300 TYR O O N N 301 TYR CB C N N 302 TYR CG C Y N 303 TYR CD1 C Y N 304 TYR CD2 C Y N 305 TYR CE1 C Y N 306 TYR CE2 C Y N 307 TYR CZ C Y N 308 TYR OH O N N 309 TYR OXT O N N 310 TYR H H N N 311 TYR H2 H N N 312 TYR HA H N N 313 TYR HB2 H N N 314 TYR HB3 H N N 315 TYR HD1 H N N 316 TYR HD2 H N N 317 TYR HE1 H N N 318 TYR HE2 H N N 319 TYR HH H N N 320 TYR HXT H N N 321 VAL N N N N 322 VAL CA C N S 323 VAL C C N N 324 VAL O O N N 325 VAL CB C N N 326 VAL CG1 C N N 327 VAL CG2 C N N 328 VAL OXT O N N 329 VAL H H N N 330 VAL H2 H N N 331 VAL HA H N N 332 VAL HB H N N 333 VAL HG11 H N N 334 VAL HG12 H N N 335 VAL HG13 H N N 336 VAL HG21 H N N 337 VAL HG22 H N N 338 VAL HG23 H N N 339 VAL HXT H N N 340 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TYR N CA sing N N 285 TYR N H sing N N 286 TYR N H2 sing N N 287 TYR CA C sing N N 288 TYR CA CB sing N N 289 TYR CA HA sing N N 290 TYR C O doub N N 291 TYR C OXT sing N N 292 TYR CB CG sing N N 293 TYR CB HB2 sing N N 294 TYR CB HB3 sing N N 295 TYR CG CD1 doub Y N 296 TYR CG CD2 sing Y N 297 TYR CD1 CE1 sing Y N 298 TYR CD1 HD1 sing N N 299 TYR CD2 CE2 doub Y N 300 TYR CD2 HD2 sing N N 301 TYR CE1 CZ doub Y N 302 TYR CE1 HE1 sing N N 303 TYR CE2 CZ sing Y N 304 TYR CE2 HE2 sing N N 305 TYR CZ OH sing N N 306 TYR OH HH sing N N 307 TYR OXT HXT sing N N 308 VAL N CA sing N N 309 VAL N H sing N N 310 VAL N H2 sing N N 311 VAL CA C sing N N 312 VAL CA CB sing N N 313 VAL CA HA sing N N 314 VAL C O doub N N 315 VAL C OXT sing N N 316 VAL CB CG1 sing N N 317 VAL CB CG2 sing N N 318 VAL CB HB sing N N 319 VAL CG1 HG11 sing N N 320 VAL CG1 HG12 sing N N 321 VAL CG1 HG13 sing N N 322 VAL CG2 HG21 sing N N 323 VAL CG2 HG22 sing N N 324 VAL CG2 HG23 sing N N 325 VAL OXT HXT sing N N 326 # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2N7R _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S # loop_ #