data_2N88 # _entry.id 2N88 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104545 RCSB ? ? 2N88 PDB pdb_00002n88 10.2210/pdb2n88/pdb 25837 BMRB ? ? D_1000104545 WWPDB ? ? # _pdbx_database_related.db_id 25837 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N88 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-10-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hennig, J.' 1 'Sattler, M.' 2 # _citation.id primary _citation.title 'Structural basis for cpSRP43 chromodomain selectivity and dynamics in Alb3 insertase interaction.' _citation.journal_abbrev 'Nat Commun' _citation.journal_volume 6 _citation.page_first 8875 _citation.page_last 8875 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2041-1723 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26568381 _citation.pdbx_database_id_DOI 10.1038/ncomms9875 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Horn, A.' 1 ? primary 'Hennig, J.' 2 ? primary 'Ahmed, Y.L.' 3 ? primary 'Stier, G.' 4 ? primary 'Wild, K.' 5 ? primary 'Sattler, M.' 6 ? primary 'Sinning, I.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Signal recognition particle 43 kDa protein, chloroplastic' _entity.formula_weight 6580.234 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'CD3 (UNP residues 316-373)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Chromo protein SRP43, CpSRP43' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQPMNE _entity_poly.pdbx_seq_one_letter_code_can GLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQPMNE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 GLU n 1 4 TYR n 1 5 ALA n 1 6 VAL n 1 7 ALA n 1 8 GLU n 1 9 SER n 1 10 VAL n 1 11 ILE n 1 12 GLY n 1 13 LYS n 1 14 ARG n 1 15 VAL n 1 16 GLY n 1 17 ASP n 1 18 ASP n 1 19 GLY n 1 20 LYS n 1 21 THR n 1 22 ILE n 1 23 GLU n 1 24 TYR n 1 25 LEU n 1 26 VAL n 1 27 LYS n 1 28 TRP n 1 29 THR n 1 30 ASP n 1 31 MET n 1 32 SER n 1 33 ASP n 1 34 ALA n 1 35 THR n 1 36 TRP n 1 37 GLU n 1 38 PRO n 1 39 GLN n 1 40 ASP n 1 41 ASN n 1 42 VAL n 1 43 ASP n 1 44 SER n 1 45 THR n 1 46 LEU n 1 47 VAL n 1 48 LEU n 1 49 LEU n 1 50 TYR n 1 51 GLN n 1 52 GLN n 1 53 GLN n 1 54 GLN n 1 55 PRO n 1 56 MET n 1 57 ASN n 1 58 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CAO, CPSRP43, At2g47450, T30B22.25' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pETtrx_1a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SR43C_ARATH _struct_ref.pdbx_db_accession O22265 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQPMNE _struct_ref.pdbx_align_begin 316 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N88 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 58 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O22265 _struct_ref_seq.db_align_beg 316 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 373 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 49 _struct_ref_seq.pdbx_auth_seq_align_end 106 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCA' 1 3 1 '3D HNCACB' 1 4 1 '3D HNCO' 1 5 1 '2D 1H-13C HSQC aliphatic' 1 6 1 '2D 1H-13C HSQC aromatic' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D HCCH-TOCSY' 1 9 2 '3D 1H-13C NOESY aliphatic' 1 10 2 '3D 1H-15N NOESY' 1 11 2 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.26 mM [U-100% 13C; U-100% 15N] CD3, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.8 mM [U-100% 13C; U-100% 15N] CD3, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker 'AVANCE III' 1 'Bruker Avance III' 600 Bruker 'AVANCE III' 2 'Bruker Avance III' # _pdbx_nmr_refine.entry_id 2N88 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 0.195 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 9 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N88 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 3 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.07 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N88 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 1 ;Linge, O'Donoghue and Nilges ; refinement ARIA 1.2 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 4 'Keller and Wuthrich' 'data analysis' CARA ? 5 'Keller and Wuthrich' 'peak picking' CARA ? 6 'Bruker Biospin' collection TopSpin ? 7 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N88 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N88 _struct.title 'Chromodomain 3 (CD3) of cpSRP43' _struct.pdbx_model_details 'closest to the average, model2' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N88 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'chromodomain, SRP, plant signaling, membrane trafficking, cpSRP, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 30 ? ALA A 34 ? ASP A 78 ALA A 82 5 ? 5 HELX_P HELX_P2 2 ASP A 43 ? GLN A 52 ? ASP A 91 GLN A 100 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 7 ? ARG A 14 ? ALA A 55 ARG A 62 A 2 GLU A 23 ? TRP A 28 ? GLU A 71 TRP A 76 A 3 THR A 35 ? PRO A 38 ? THR A 83 PRO A 86 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 9 ? N SER A 57 O LYS A 27 ? O LYS A 75 A 2 3 N TYR A 24 ? N TYR A 72 O GLU A 37 ? O GLU A 85 # _atom_sites.entry_id 2N88 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 49 49 GLY GLY A . n A 1 2 LEU 2 50 50 LEU LEU A . n A 1 3 GLU 3 51 51 GLU GLU A . n A 1 4 TYR 4 52 52 TYR TYR A . n A 1 5 ALA 5 53 53 ALA ALA A . n A 1 6 VAL 6 54 54 VAL VAL A . n A 1 7 ALA 7 55 55 ALA ALA A . n A 1 8 GLU 8 56 56 GLU GLU A . n A 1 9 SER 9 57 57 SER SER A . n A 1 10 VAL 10 58 58 VAL VAL A . n A 1 11 ILE 11 59 59 ILE ILE A . n A 1 12 GLY 12 60 60 GLY GLY A . n A 1 13 LYS 13 61 61 LYS LYS A . n A 1 14 ARG 14 62 62 ARG ARG A . n A 1 15 VAL 15 63 63 VAL VAL A . n A 1 16 GLY 16 64 64 GLY GLY A . n A 1 17 ASP 17 65 65 ASP ASP A . n A 1 18 ASP 18 66 66 ASP ASP A . n A 1 19 GLY 19 67 67 GLY GLY A . n A 1 20 LYS 20 68 68 LYS LYS A . n A 1 21 THR 21 69 69 THR THR A . n A 1 22 ILE 22 70 70 ILE ILE A . n A 1 23 GLU 23 71 71 GLU GLU A . n A 1 24 TYR 24 72 72 TYR TYR A . n A 1 25 LEU 25 73 73 LEU LEU A . n A 1 26 VAL 26 74 74 VAL VAL A . n A 1 27 LYS 27 75 75 LYS LYS A . n A 1 28 TRP 28 76 76 TRP TRP A . n A 1 29 THR 29 77 77 THR THR A . n A 1 30 ASP 30 78 78 ASP ASP A . n A 1 31 MET 31 79 79 MET MET A . n A 1 32 SER 32 80 80 SER SER A . n A 1 33 ASP 33 81 81 ASP ASP A . n A 1 34 ALA 34 82 82 ALA ALA A . n A 1 35 THR 35 83 83 THR THR A . n A 1 36 TRP 36 84 84 TRP TRP A . n A 1 37 GLU 37 85 85 GLU GLU A . n A 1 38 PRO 38 86 86 PRO PRO A . n A 1 39 GLN 39 87 87 GLN GLN A . n A 1 40 ASP 40 88 88 ASP ASP A . n A 1 41 ASN 41 89 89 ASN ASN A . n A 1 42 VAL 42 90 90 VAL VAL A . n A 1 43 ASP 43 91 91 ASP ASP A . n A 1 44 SER 44 92 92 SER SER A . n A 1 45 THR 45 93 93 THR THR A . n A 1 46 LEU 46 94 94 LEU LEU A . n A 1 47 VAL 47 95 95 VAL VAL A . n A 1 48 LEU 48 96 96 LEU LEU A . n A 1 49 LEU 49 97 97 LEU LEU A . n A 1 50 TYR 50 98 98 TYR TYR A . n A 1 51 GLN 51 99 99 GLN GLN A . n A 1 52 GLN 52 100 100 GLN GLN A . n A 1 53 GLN 53 101 101 GLN GLN A . n A 1 54 GLN 54 102 102 GLN GLN A . n A 1 55 PRO 55 103 103 PRO PRO A . n A 1 56 MET 56 104 104 MET MET A . n A 1 57 ASN 57 105 105 ASN ASN A . n A 1 58 GLU 58 106 106 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-09 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.009 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0 _pdbx_nmr_ensemble_rms.entry_id 2N88 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id CD3-1 0.26 ? mM '[U-100% 13C; U-100% 15N]' 1 CD3-2 0.8 ? mM '[U-100% 13C; U-100% 15N]' 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2N88 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 792 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 219 _pdbx_nmr_constraints.NOE_long_range_total_count 251 _pdbx_nmr_constraints.NOE_medium_range_total_count 109 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 213 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 42 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 43 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HB2 A TRP 76 ? ? HB3 A MET 79 ? ? 1.28 2 5 HA3 A GLY 64 ? ? HB2 A LYS 68 ? ? 1.34 3 9 HA3 A GLY 64 ? ? HB3 A LYS 68 ? ? 1.27 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 52 ? ? 75.23 168.88 2 1 PRO A 103 ? ? -67.44 92.13 3 1 ASN A 105 ? ? 67.38 74.86 4 2 LEU A 50 ? ? -93.52 52.27 5 2 ALA A 53 ? ? 65.58 106.75 6 2 MET A 79 ? ? -54.67 -7.83 7 2 PRO A 103 ? ? -68.38 95.15 8 2 ASN A 105 ? ? -125.85 -66.62 9 3 ASP A 81 ? ? -71.89 42.65 10 3 ALA A 82 ? ? -43.51 151.21 11 3 ASN A 105 ? ? -141.57 -61.35 12 4 TYR A 52 ? ? -129.32 -157.05 13 4 MET A 79 ? ? -91.72 41.43 14 4 ASP A 81 ? ? -71.50 46.33 15 4 ALA A 82 ? ? -41.52 152.95 16 5 GLU A 51 ? ? 57.35 71.35 17 5 TYR A 52 ? ? 72.50 176.90 18 5 ALA A 53 ? ? 67.61 83.79 19 5 MET A 79 ? ? -90.01 40.48 20 5 ASP A 81 ? ? -71.18 43.65 21 6 MET A 79 ? ? -90.17 40.94 22 6 ASP A 81 ? ? -70.81 45.30 23 7 ALA A 53 ? ? -173.68 94.80 24 7 MET A 79 ? ? -81.55 43.76 25 7 SER A 80 ? ? -44.08 -17.78 26 7 ASP A 81 ? ? -70.74 45.44 27 7 PRO A 103 ? ? -66.87 96.62 28 8 MET A 79 ? ? -148.24 -72.53 29 8 ALA A 82 ? ? -65.48 98.38 30 8 MET A 104 ? ? -138.37 -53.00 31 8 ASN A 105 ? ? 53.97 73.02 32 9 MET A 79 ? ? -149.31 -73.79 33 9 ASP A 81 ? ? -72.76 21.49 #