data_2N90 # _entry.id 2N90 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104573 RCSB ? ? 2N90 PDB pdb_00002n90 10.2210/pdb2n90/pdb 25872 BMRB ? ? D_1000104573 WWPDB ? ? # _pdbx_database_related.db_id 25872 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N90 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-10-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nadezhdin, K.' 1 'Goncharuk, S.' 2 'Arseniev, A.' 3 # _citation.id primary _citation.title ;Structural basis of the transmembrane domain dimerization and rotation in the activation mechanism of the TRKA receptor by nerve growth factor. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 295 _citation.page_first 275 _citation.page_last 286 _citation.year 2020 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 1083-351X _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 31801826 _citation.pdbx_database_id_DOI 10.1074/jbc.RA119.011312 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Franco, M.L.' 1 ? primary 'Nadezhdin, K.D.' 2 ? primary 'Goncharuk, S.A.' 3 ? primary 'Mineev, K.S.' 4 0000-0002-2418-9421 primary 'Arseniev, A.S.' 5 ? primary 'Vilar, M.' 6 0000-0002-9376-6544 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'High affinity nerve growth factor receptor' _entity.formula_weight 4214.092 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec 2.7.10.1 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Neurotrophic tyrosine kinase receptor type 1, TRK1-transforming tyrosine kinase protein, Tropomyosin-related kinase A, Tyrosine kinase receptor, Tyrosine kinase receptor A, Trk-A, gp140trk, p140-TrkA ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK _entity_poly.pdbx_seq_one_letter_code_can MKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LYS n 1 4 ASP n 1 5 GLU n 1 6 THR n 1 7 PRO n 1 8 PHE n 1 9 GLY n 1 10 VAL n 1 11 SER n 1 12 VAL n 1 13 ALA n 1 14 VAL n 1 15 GLY n 1 16 LEU n 1 17 ALA n 1 18 VAL n 1 19 PHE n 1 20 ALA n 1 21 CYS n 1 22 LEU n 1 23 PHE n 1 24 LEU n 1 25 SER n 1 26 THR n 1 27 LEU n 1 28 LEU n 1 29 LEU n 1 30 VAL n 1 31 LEU n 1 32 ASN n 1 33 LYS n 1 34 ALA n 1 35 GLY n 1 36 ARG n 1 37 ARG n 1 38 ASN n 1 39 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NTRK1, MTC, TRK, TRKA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pGEMEX-1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NTRK1_HUMAN _struct_ref.pdbx_db_accession P04629 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNK _struct_ref.pdbx_align_begin 410 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2N90 A 2 ? 39 ? P04629 410 ? 447 ? 2 39 2 1 2N90 B 2 ? 39 ? P04629 410 ? 447 ? 102 139 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N90 MET A 1 ? UNP P04629 ? ? 'expression tag' 1 1 1 2N90 ALA A 34 ? UNP P04629 CYS 442 conflict 34 2 2 2N90 MET B 1 ? UNP P04629 ? ? 'expression tag' 101 3 2 2N90 ALA B 34 ? UNP P04629 CYS 442 conflict 134 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D HNCACB' 1 6 1 '3D HNHA' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 1 '3D HN(CO)CA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 5.9 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-100% 13C; U-100% 15N] protein, 1 mM protein, 40 mM [U-100% 2H] DPC, 20 mM potassium phosphate, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2N90 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N90 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N90 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Bruker Biospin' processing TopSpin ? 2 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 4 'Koradi, Billeter and Wuthrich' visualization MOLMOL ? 5 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 6 'Keller and Wuthrich' 'data analysis' CARA ? 7 'Keller and Wuthrich' 'peak picking' CARA ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N90 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N90 _struct.title 'TrkA transmembrane domain NMR structure in DPC micelles' _struct.pdbx_model_details 'fewest violations, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N90 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'neurotrophin receptor, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 9 ? ALA A 34 ? GLY A 9 ALA A 34 1 ? 26 HELX_P HELX_P2 2 GLY B 9 ? ALA B 34 ? GLY B 109 ALA B 134 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2N90 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LYS 39 39 39 LYS LYS A . n B 1 1 MET 1 101 101 MET MET B . n B 1 2 LYS 2 102 102 LYS LYS B . n B 1 3 LYS 3 103 103 LYS LYS B . n B 1 4 ASP 4 104 104 ASP ASP B . n B 1 5 GLU 5 105 105 GLU GLU B . n B 1 6 THR 6 106 106 THR THR B . n B 1 7 PRO 7 107 107 PRO PRO B . n B 1 8 PHE 8 108 108 PHE PHE B . n B 1 9 GLY 9 109 109 GLY GLY B . n B 1 10 VAL 10 110 110 VAL VAL B . n B 1 11 SER 11 111 111 SER SER B . n B 1 12 VAL 12 112 112 VAL VAL B . n B 1 13 ALA 13 113 113 ALA ALA B . n B 1 14 VAL 14 114 114 VAL VAL B . n B 1 15 GLY 15 115 115 GLY GLY B . n B 1 16 LEU 16 116 116 LEU LEU B . n B 1 17 ALA 17 117 117 ALA ALA B . n B 1 18 VAL 18 118 118 VAL VAL B . n B 1 19 PHE 19 119 119 PHE PHE B . n B 1 20 ALA 20 120 120 ALA ALA B . n B 1 21 CYS 21 121 121 CYS CYS B . n B 1 22 LEU 22 122 122 LEU LEU B . n B 1 23 PHE 23 123 123 PHE PHE B . n B 1 24 LEU 24 124 124 LEU LEU B . n B 1 25 SER 25 125 125 SER SER B . n B 1 26 THR 26 126 126 THR THR B . n B 1 27 LEU 27 127 127 LEU LEU B . n B 1 28 LEU 28 128 128 LEU LEU B . n B 1 29 LEU 29 129 129 LEU LEU B . n B 1 30 VAL 30 130 130 VAL VAL B . n B 1 31 LEU 31 131 131 LEU LEU B . n B 1 32 ASN 32 132 132 ASN ASN B . n B 1 33 LYS 33 133 133 LYS LYS B . n B 1 34 ALA 34 134 134 ALA ALA B . n B 1 35 GLY 35 135 135 GLY GLY B . n B 1 36 ARG 36 136 136 ARG ARG B . n B 1 37 ARG 37 137 137 ARG ARG B . n B 1 38 ASN 38 138 138 ASN ASN B . n B 1 39 LYS 39 139 139 LYS LYS B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-11-09 2 'Structure model' 1 1 2021-02-10 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_pdbx_nmr_software.name' 14 2 'Structure model' '_pdbx_nmr_spectrometer.model' 15 2 'Structure model' '_struct_ref_seq_dif.details' 16 3 'Structure model' '_database_2.pdbx_DOI' 17 3 'Structure model' '_database_2.pdbx_database_accession' 18 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1 ? mM '[U-100% 13C; U-100% 15N]' 1 entity-2 1 ? mM ? 1 DPC-3 40 ? mM '[U-100% 2H]' 1 'potassium phosphate-4' 20 ? mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 4 ? ? -68.79 -177.65 2 1 GLU A 5 ? ? -167.36 76.24 3 1 GLU B 105 ? ? -171.03 73.68 4 2 GLU A 5 ? ? -58.35 -70.95 5 2 ALA A 34 ? ? -161.06 102.30 6 2 ALA B 134 ? ? -162.94 101.26 7 3 PHE A 8 ? ? -178.25 114.30 8 3 PHE B 108 ? ? -179.07 114.15 9 5 GLU A 5 ? ? -172.93 74.30 10 5 ALA A 34 ? ? -164.87 104.77 11 5 GLU B 105 ? ? -174.37 72.20 12 5 ALA B 134 ? ? -174.74 106.35 13 6 GLU A 5 ? ? -167.56 79.23 14 6 GLU B 105 ? ? -168.78 76.80 15 7 GLU A 5 ? ? -170.89 83.71 16 7 GLU B 105 ? ? -171.91 81.94 17 8 ALA B 134 ? ? -161.15 94.72 18 9 GLU A 5 ? ? -166.06 90.54 19 9 GLU B 105 ? ? -168.72 89.01 20 10 GLU A 5 ? ? -172.16 84.58 21 10 GLU B 105 ? ? -173.43 79.95 #