data_2N95 # _entry.id 2N95 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104578 RCSB ? ? 2N95 PDB pdb_00002n95 10.2210/pdb2n95/pdb 25881 BMRB ? 10.13018/BMR25881 D_1000104578 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-05-11 2 'Structure model' 1 1 2016-07-27 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_conn_angle 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond 10 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.value' 18 3 'Structure model' '_struct_conn.pdbx_dist_value' 19 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 3 'Structure model' '_struct_ref_seq_dif.details' 27 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 3 'Structure model' '_struct_site.pdbx_auth_seq_id' 30 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N95 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-11-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25881 BMRB unspecified . 2N94 PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bragantini, B.' 1 'Quinternet, M.' 2 'Manival, X.' 3 # _citation.id primary _citation.title 'Functional and Structural Insights of the Zinc-Finger HIT protein family members Involved in Box C/D snoRNP Biogenesis.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 428 _citation.page_first 2488 _citation.page_last 2506 _citation.year 2016 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27139642 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2016.04.028 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bragantini, B.' 1 ? primary 'Tiotiu, D.' 2 ? primary 'Rothe, B.' 3 ? primary 'Saliou, J.M.' 4 ? primary 'Marty, H.' 5 ? primary 'Cianferani, S.' 6 ? primary 'Charpentier, B.' 7 ? primary 'Quinternet, M.' 8 ? primary 'Manival, X.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein HIT1' 5399.389 1 ? ? 'zinc finger domain (UNP residues 1-46)' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPHMVSSAVKCGICRGVDGKYKCPKCGVRYCSLKCYKDAAKHVHKESEQ _entity_poly.pdbx_seq_one_letter_code_can GPHMVSSAVKCGICRGVDGKYKCPKCGVRYCSLKCYKDAAKHVHKESEQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 HIS n 1 4 MET n 1 5 VAL n 1 6 SER n 1 7 SER n 1 8 ALA n 1 9 VAL n 1 10 LYS n 1 11 CYS n 1 12 GLY n 1 13 ILE n 1 14 CYS n 1 15 ARG n 1 16 GLY n 1 17 VAL n 1 18 ASP n 1 19 GLY n 1 20 LYS n 1 21 TYR n 1 22 LYS n 1 23 CYS n 1 24 PRO n 1 25 LYS n 1 26 CYS n 1 27 GLY n 1 28 VAL n 1 29 ARG n 1 30 TYR n 1 31 CYS n 1 32 SER n 1 33 LEU n 1 34 LYS n 1 35 CYS n 1 36 TYR n 1 37 LYS n 1 38 ASP n 1 39 ALA n 1 40 ALA n 1 41 LYS n 1 42 HIS n 1 43 VAL n 1 44 HIS n 1 45 LYS n 1 46 GLU n 1 47 SER n 1 48 GLU n 1 49 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HIT1, YJR055W, J1705' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pnEA-3cH _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 -2 GLY GLY A . n A 1 2 PRO 2 -1 -1 PRO PRO A . n A 1 3 HIS 3 0 0 HIS HIS A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 VAL 5 2 2 VAL VAL A . n A 1 6 SER 6 3 3 SER SER A . n A 1 7 SER 7 4 4 SER SER A . n A 1 8 ALA 8 5 5 ALA ALA A . n A 1 9 VAL 9 6 6 VAL VAL A . n A 1 10 LYS 10 7 7 LYS LYS A . n A 1 11 CYS 11 8 8 CYS CYS A . n A 1 12 GLY 12 9 9 GLY GLY A . n A 1 13 ILE 13 10 10 ILE ILE A . n A 1 14 CYS 14 11 11 CYS CYS A . n A 1 15 ARG 15 12 12 ARG ARG A . n A 1 16 GLY 16 13 13 GLY GLY A . n A 1 17 VAL 17 14 14 VAL VAL A . n A 1 18 ASP 18 15 15 ASP ASP A . n A 1 19 GLY 19 16 16 GLY GLY A . n A 1 20 LYS 20 17 17 LYS LYS A . n A 1 21 TYR 21 18 18 TYR TYR A . n A 1 22 LYS 22 19 19 LYS LYS A . n A 1 23 CYS 23 20 20 CYS CYS A . n A 1 24 PRO 24 21 21 PRO PRO A . n A 1 25 LYS 25 22 22 LYS LYS A . n A 1 26 CYS 26 23 23 CYS CYS A . n A 1 27 GLY 27 24 24 GLY GLY A . n A 1 28 VAL 28 25 25 VAL VAL A . n A 1 29 ARG 29 26 26 ARG ARG A . n A 1 30 TYR 30 27 27 TYR TYR A . n A 1 31 CYS 31 28 28 CYS CYS A . n A 1 32 SER 32 29 29 SER SER A . n A 1 33 LEU 33 30 30 LEU LEU A . n A 1 34 LYS 34 31 31 LYS LYS A . n A 1 35 CYS 35 32 32 CYS CYS A . n A 1 36 TYR 36 33 33 TYR TYR A . n A 1 37 LYS 37 34 34 LYS LYS A . n A 1 38 ASP 38 35 35 ASP ASP A . n A 1 39 ALA 39 36 36 ALA ALA A . n A 1 40 ALA 40 37 37 ALA ALA A . n A 1 41 LYS 41 38 38 LYS LYS A . n A 1 42 HIS 42 39 39 HIS HIS A . n A 1 43 VAL 43 40 40 VAL VAL A . n A 1 44 HIS 44 41 41 HIS HIS A . n A 1 45 LYS 45 42 42 LYS LYS A . n A 1 46 GLU 46 43 43 GLU GLU A . n A 1 47 SER 47 44 44 SER SER A . n A 1 48 GLU 48 45 45 GLU GLU A . n A 1 49 GLN 49 46 46 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 150 ZN ZN A . C 2 ZN 1 102 170 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N95 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N95 _struct.title 'NMR structure of yeast Hit1 protein zinc finger' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N95 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'Hit1, Zinc Finger, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HIT1_YEAST _struct_ref.pdbx_db_accession P46973 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MVSSAVKCGICRGVDGKYKCPKCGVRYCSLKCYKDAAKHVHKESEQ _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N95 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P46973 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 46 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 46 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N95 GLY A 1 ? UNP P46973 ? ? 'expression tag' -2 1 1 2N95 PRO A 2 ? UNP P46973 ? ? 'expression tag' -1 2 1 2N95 HIS A 3 ? UNP P46973 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 32 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 37 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 29 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 34 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 8 A ZN 101 1_555 ? ? ? ? ? ? ? 2.295 ? ? metalc2 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 101 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc3 metalc ? ? A CYS 23 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 20 A ZN 102 1_555 ? ? ? ? ? ? ? 2.305 ? ? metalc4 metalc ? ? A CYS 26 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 23 A ZN 102 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc5 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 101 1_555 ? ? ? ? ? ? ? 2.307 ? ? metalc6 metalc ? ? A CYS 35 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 32 A ZN 101 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc7 metalc ? ? A HIS 42 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 39 A ZN 102 1_555 ? ? ? ? ? ? ? 2.284 ? ? metalc8 metalc ? ? A HIS 44 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 41 A ZN 102 1_555 ? ? ? ? ? ? ? 2.002 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 11 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 14 ? A CYS 11 ? 1_555 105.9 ? 2 SG ? A CYS 11 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 31 ? A CYS 28 ? 1_555 108.6 ? 3 SG ? A CYS 14 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 31 ? A CYS 28 ? 1_555 112.3 ? 4 SG ? A CYS 11 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 35 ? A CYS 32 ? 1_555 109.1 ? 5 SG ? A CYS 14 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 35 ? A CYS 32 ? 1_555 109.9 ? 6 SG ? A CYS 31 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 35 ? A CYS 32 ? 1_555 110.8 ? 7 SG ? A CYS 23 ? A CYS 20 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 26 ? A CYS 23 ? 1_555 104.3 ? 8 SG ? A CYS 23 ? A CYS 20 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NE2 ? A HIS 42 ? A HIS 39 ? 1_555 89.0 ? 9 SG ? A CYS 26 ? A CYS 23 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NE2 ? A HIS 42 ? A HIS 39 ? 1_555 112.8 ? 10 SG ? A CYS 23 ? A CYS 20 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NE2 ? A HIS 44 ? A HIS 41 ? 1_555 104.9 ? 11 SG ? A CYS 26 ? A CYS 23 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NE2 ? A HIS 44 ? A HIS 41 ? 1_555 106.2 ? 12 NE2 ? A HIS 42 ? A HIS 39 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NE2 ? A HIS 44 ? A HIS 41 ? 1_555 133.7 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 21 ? LYS A 22 ? TYR A 18 LYS A 19 A 2 ARG A 29 ? TYR A 30 ? ARG A 26 TYR A 27 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 21 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 18 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 30 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 27 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 101 ? 4 'BINDING SITE FOR RESIDUE ZN A 101' AC2 Software A ZN 102 ? 4 'BINDING SITE FOR RESIDUE ZN A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 11 ? CYS A 8 . ? 1_555 ? 2 AC1 4 CYS A 14 ? CYS A 11 . ? 1_555 ? 3 AC1 4 CYS A 31 ? CYS A 28 . ? 1_555 ? 4 AC1 4 CYS A 35 ? CYS A 32 . ? 1_555 ? 5 AC2 4 CYS A 23 ? CYS A 20 . ? 1_555 ? 6 AC2 4 CYS A 26 ? CYS A 23 . ? 1_555 ? 7 AC2 4 HIS A 42 ? HIS A 39 . ? 1_555 ? 8 AC2 4 HIS A 44 ? HIS A 41 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 35 ? ? H A LYS 38 ? ? 1.56 2 1 HZ1 A LYS 42 ? ? OE1 A GLU 45 ? ? 1.57 3 3 OD1 A ASP 35 ? ? H A LYS 38 ? ? 1.59 4 4 OD2 A ASP 35 ? ? H A LYS 38 ? ? 1.57 5 4 O A CYS 28 ? ? HG A SER 29 ? ? 1.60 6 5 OD1 A ASP 35 ? ? H A LYS 38 ? ? 1.56 7 7 OD2 A ASP 35 ? ? H A LYS 38 ? ? 1.59 8 10 OD1 A ASP 35 ? ? H A LYS 38 ? ? 1.60 9 12 OD1 A ASP 35 ? ? H A LYS 38 ? ? 1.57 10 13 OD2 A ASP 35 ? ? H A LYS 38 ? ? 1.58 11 16 OD1 A ASP 35 ? ? H A LYS 38 ? ? 1.60 12 18 OD1 A ASP 35 ? ? H A LYS 38 ? ? 1.60 13 19 OD2 A ASP 35 ? ? H A LYS 38 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? 61.23 68.88 2 1 VAL A 14 ? ? -118.34 -169.69 3 1 SER A 29 ? ? -177.19 -171.64 4 1 GLU A 43 ? ? 67.00 -82.12 5 2 VAL A 14 ? ? -119.22 -169.41 6 2 SER A 29 ? ? -176.94 -169.44 7 2 LYS A 34 ? ? -89.65 45.82 8 3 PRO A -1 ? ? -79.75 20.24 9 3 HIS A 0 ? ? 71.89 -71.97 10 3 SER A 29 ? ? 176.54 -171.42 11 3 GLU A 43 ? ? 61.09 -168.19 12 3 SER A 44 ? ? 64.54 -72.85 13 4 HIS A 0 ? ? -115.31 50.09 14 4 MET A 1 ? ? 67.27 168.54 15 4 SER A 3 ? ? 71.81 -31.21 16 4 LYS A 34 ? ? -85.50 47.67 17 4 LYS A 42 ? ? 70.55 -60.97 18 4 SER A 44 ? ? -154.29 82.79 19 5 SER A 29 ? ? -176.10 -170.31 20 5 LYS A 34 ? ? -87.39 49.78 21 5 HIS A 41 ? ? -126.85 -56.07 22 6 HIS A 0 ? ? -102.51 62.04 23 6 SER A 29 ? ? 178.25 -167.92 24 6 LYS A 34 ? ? -85.18 45.89 25 6 LYS A 42 ? ? -115.72 -71.60 26 6 GLU A 43 ? ? 63.44 141.07 27 6 SER A 44 ? ? 71.19 -60.29 28 7 VAL A 14 ? ? -115.32 -169.35 29 7 PRO A 21 ? ? -69.42 2.33 30 7 SER A 29 ? ? -173.50 -167.62 31 7 LYS A 34 ? ? -87.70 47.21 32 8 VAL A 14 ? ? -112.35 -169.94 33 8 SER A 29 ? ? -176.05 -167.44 34 8 LYS A 34 ? ? -88.61 41.89 35 9 HIS A 0 ? ? -141.30 28.98 36 9 MET A 1 ? ? -166.35 115.23 37 9 SER A 29 ? ? -171.12 -169.41 38 9 LYS A 42 ? ? -85.98 -152.70 39 9 GLU A 43 ? ? -63.99 96.15 40 10 SER A 29 ? ? 179.08 -171.39 41 11 MET A 1 ? ? -87.45 -72.04 42 11 VAL A 2 ? ? 37.80 47.78 43 11 ALA A 5 ? ? 65.99 -172.07 44 11 VAL A 14 ? ? -110.27 -169.10 45 11 PRO A 21 ? ? -68.97 0.42 46 11 LYS A 22 ? ? -94.14 -63.81 47 11 SER A 29 ? ? 176.93 -168.02 48 11 LYS A 34 ? ? -91.47 39.81 49 12 VAL A 14 ? ? -114.84 -169.63 50 12 LYS A 34 ? ? -87.48 44.23 51 12 HIS A 41 ? ? -117.63 -169.38 52 12 GLU A 43 ? ? -153.74 -41.41 53 13 SER A 4 ? ? -97.80 38.66 54 13 VAL A 14 ? ? -113.42 -169.56 55 13 SER A 29 ? ? -176.11 -171.20 56 13 LYS A 34 ? ? -85.06 48.16 57 14 VAL A 14 ? ? -118.10 -169.54 58 14 PRO A 21 ? ? -68.11 0.03 59 14 LYS A 22 ? ? -96.16 -60.32 60 14 LYS A 34 ? ? -85.27 43.56 61 15 HIS A 41 ? ? -123.72 -74.75 62 15 LYS A 42 ? ? -162.69 21.63 63 15 GLU A 45 ? ? -91.28 34.41 64 16 VAL A 2 ? ? 60.04 60.68 65 16 VAL A 14 ? ? -109.03 -168.96 66 16 SER A 29 ? ? -168.62 -169.92 67 17 VAL A 2 ? ? 71.47 -54.77 68 17 VAL A 14 ? ? -120.79 -168.87 69 17 SER A 29 ? ? -178.28 -169.39 70 17 LYS A 34 ? ? -90.72 35.52 71 18 HIS A 0 ? ? -86.56 46.33 72 18 VAL A 14 ? ? -120.46 -168.91 73 18 GLU A 43 ? ? 72.59 -65.60 74 19 MET A 1 ? ? 68.28 111.29 75 19 SER A 29 ? ? -175.94 -171.35 76 19 LYS A 42 ? ? 68.72 134.41 77 19 GLU A 43 ? ? -88.17 -156.72 78 19 GLU A 45 ? ? -145.73 -51.40 79 20 SER A 4 ? ? 60.53 78.64 80 20 SER A 29 ? ? -175.08 -177.03 81 20 LYS A 34 ? ? -89.55 47.34 82 20 GLU A 45 ? ? -103.26 41.54 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 250 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N95 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N95 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents ;2.2 mM [U-100% 13C; U-100% 15N] protein, 10 mM sodium phosphate, 150 mM sodium chloride, 0.5 mM TCEP, 3 mM [U-2H] DTT, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 2.2 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 10 ? mM ? 1 'sodium chloride-3' 150 ? mM ? 1 TCEP-4 0.5 ? mM ? 1 DTT-5 3 ? mM '[U-2H]' 1 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 160 6.4 ambient ? 298 K 2 160 6.4 ambient ? 313 K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-15N HSQC' 1 3 1 '2D 1H-13C HSQC aliphatic' 1 4 1 '2D 1H-13C HSQC aromatic' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HNCO' 1 7 1 '3D HNCA' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY aliphatic' 1 11 1 '3D 1H-13C NOESY aromatic' 1 12 1 '2D 1H-15N HSQC long range' 2 13 1 '2D 1H-1H NOESY' 2 14 1 '2D 1H-15N HSQC' 2 15 1 '2D 1H-15N HSQC long range' 2 16 1 '2D 1H-13C HSQC aliphatic' 2 17 1 '2D 1H-13C HSQC aromatic' 2 18 1 '3D 1H-15N NOESY' 2 19 1 '3D 1H-13C NOESY aliphatic' # _pdbx_nmr_refine.entry_id 2N95 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 PRO N N N N 230 PRO CA C N S 231 PRO C C N N 232 PRO O O N N 233 PRO CB C N N 234 PRO CG C N N 235 PRO CD C N N 236 PRO OXT O N N 237 PRO H H N N 238 PRO HA H N N 239 PRO HB2 H N N 240 PRO HB3 H N N 241 PRO HG2 H N N 242 PRO HG3 H N N 243 PRO HD2 H N N 244 PRO HD3 H N N 245 PRO HXT H N N 246 SER N N N N 247 SER CA C N S 248 SER C C N N 249 SER O O N N 250 SER CB C N N 251 SER OG O N N 252 SER OXT O N N 253 SER H H N N 254 SER H2 H N N 255 SER HA H N N 256 SER HB2 H N N 257 SER HB3 H N N 258 SER HG H N N 259 SER HXT H N N 260 TYR N N N N 261 TYR CA C N S 262 TYR C C N N 263 TYR O O N N 264 TYR CB C N N 265 TYR CG C Y N 266 TYR CD1 C Y N 267 TYR CD2 C Y N 268 TYR CE1 C Y N 269 TYR CE2 C Y N 270 TYR CZ C Y N 271 TYR OH O N N 272 TYR OXT O N N 273 TYR H H N N 274 TYR H2 H N N 275 TYR HA H N N 276 TYR HB2 H N N 277 TYR HB3 H N N 278 TYR HD1 H N N 279 TYR HD2 H N N 280 TYR HE1 H N N 281 TYR HE2 H N N 282 TYR HH H N N 283 TYR HXT H N N 284 VAL N N N N 285 VAL CA C N S 286 VAL C C N N 287 VAL O O N N 288 VAL CB C N N 289 VAL CG1 C N N 290 VAL CG2 C N N 291 VAL OXT O N N 292 VAL H H N N 293 VAL H2 H N N 294 VAL HA H N N 295 VAL HB H N N 296 VAL HG11 H N N 297 VAL HG12 H N N 298 VAL HG13 H N N 299 VAL HG21 H N N 300 VAL HG22 H N N 301 VAL HG23 H N N 302 VAL HXT H N N 303 ZN ZN ZN N N 304 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 MET N CA sing N N 200 MET N H sing N N 201 MET N H2 sing N N 202 MET CA C sing N N 203 MET CA CB sing N N 204 MET CA HA sing N N 205 MET C O doub N N 206 MET C OXT sing N N 207 MET CB CG sing N N 208 MET CB HB2 sing N N 209 MET CB HB3 sing N N 210 MET CG SD sing N N 211 MET CG HG2 sing N N 212 MET CG HG3 sing N N 213 MET SD CE sing N N 214 MET CE HE1 sing N N 215 MET CE HE2 sing N N 216 MET CE HE3 sing N N 217 MET OXT HXT sing N N 218 PRO N CA sing N N 219 PRO N CD sing N N 220 PRO N H sing N N 221 PRO CA C sing N N 222 PRO CA CB sing N N 223 PRO CA HA sing N N 224 PRO C O doub N N 225 PRO C OXT sing N N 226 PRO CB CG sing N N 227 PRO CB HB2 sing N N 228 PRO CB HB3 sing N N 229 PRO CG CD sing N N 230 PRO CG HG2 sing N N 231 PRO CG HG3 sing N N 232 PRO CD HD2 sing N N 233 PRO CD HD3 sing N N 234 PRO OXT HXT sing N N 235 SER N CA sing N N 236 SER N H sing N N 237 SER N H2 sing N N 238 SER CA C sing N N 239 SER CA CB sing N N 240 SER CA HA sing N N 241 SER C O doub N N 242 SER C OXT sing N N 243 SER CB OG sing N N 244 SER CB HB2 sing N N 245 SER CB HB3 sing N N 246 SER OG HG sing N N 247 SER OXT HXT sing N N 248 TYR N CA sing N N 249 TYR N H sing N N 250 TYR N H2 sing N N 251 TYR CA C sing N N 252 TYR CA CB sing N N 253 TYR CA HA sing N N 254 TYR C O doub N N 255 TYR C OXT sing N N 256 TYR CB CG sing N N 257 TYR CB HB2 sing N N 258 TYR CB HB3 sing N N 259 TYR CG CD1 doub Y N 260 TYR CG CD2 sing Y N 261 TYR CD1 CE1 sing Y N 262 TYR CD1 HD1 sing N N 263 TYR CD2 CE2 doub Y N 264 TYR CD2 HD2 sing N N 265 TYR CE1 CZ doub Y N 266 TYR CE1 HE1 sing N N 267 TYR CE2 CZ sing Y N 268 TYR CE2 HE2 sing N N 269 TYR CZ OH sing N N 270 TYR OH HH sing N N 271 TYR OXT HXT sing N N 272 VAL N CA sing N N 273 VAL N H sing N N 274 VAL N H2 sing N N 275 VAL CA C sing N N 276 VAL CA CB sing N N 277 VAL CA HA sing N N 278 VAL C O doub N N 279 VAL C OXT sing N N 280 VAL CB CG1 sing N N 281 VAL CB CG2 sing N N 282 VAL CB HB sing N N 283 VAL CG1 HG11 sing N N 284 VAL CG1 HG12 sing N N 285 VAL CG1 HG13 sing N N 286 VAL CG2 HG21 sing N N 287 VAL CG2 HG22 sing N N 288 VAL CG2 HG23 sing N N 289 VAL OXT HXT sing N N 290 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2N95 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_