data_2N9O # _entry.id 2N9O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104597 RCSB ? ? 2N9O PDB pdb_00002n9o 10.2210/pdb2n9o/pdb 25913 BMRB ? ? D_1000104597 WWPDB ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25913 BMRB unspecified . 2N9P PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N9O _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-12-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Martinez-Lumbreras, S.' 1 'Krysztofinska, E.M.' 2 'Thapaliya, A.' 3 'Isaacson, R.L.' 4 # _citation.id primary _citation.title 'Structural and functional insights into the E3 ligase, RNF126.' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 6 _citation.page_first 26433 _citation.page_last 26433 _citation.year 2016 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27193484 _citation.pdbx_database_id_DOI 10.1038/srep26433 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Krysztofinska, E.M.' 1 ? primary 'Martinez-Lumbreras, S.' 2 ? primary 'Thapaliya, A.' 3 ? primary 'Evans, N.J.' 4 ? primary 'High, S.' 5 ? primary 'Isaacson, R.L.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase RNF126' 4705.398 1 6.3.2.- ? 'N-terminal zinc finger domain residues 1-40' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RING finger protein 126' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSMAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEEL _entity_poly.pdbx_seq_one_letter_code_can GSMAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEEL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 ALA n 1 5 GLU n 1 6 ALA n 1 7 SER n 1 8 PRO n 1 9 HIS n 1 10 PRO n 1 11 GLY n 1 12 ARG n 1 13 TYR n 1 14 PHE n 1 15 CYS n 1 16 HIS n 1 17 CYS n 1 18 CYS n 1 19 SER n 1 20 VAL n 1 21 GLU n 1 22 ILE n 1 23 VAL n 1 24 PRO n 1 25 ARG n 1 26 LEU n 1 27 PRO n 1 28 ASP n 1 29 TYR n 1 30 ILE n 1 31 CYS n 1 32 PRO n 1 33 ARG n 1 34 CYS n 1 35 GLU n 1 36 SER n 1 37 GLY n 1 38 PHE n 1 39 ILE n 1 40 GLU n 1 41 GLU n 1 42 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene RNF126 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET28 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RN126_HUMAN _struct_ref.pdbx_db_accession Q9BV68 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEEL _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N9O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 42 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BV68 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 40 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 40 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N9O GLY A 1 ? UNP Q9BV68 ? ? 'expression tag' -1 1 1 2N9O SER A 2 ? UNP Q9BV68 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '2D 1H-1H TOCSY' 1 4 1 '2D 1H-1H NOESY' 1 5 2 '2D 1H-1H NOESY' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HNCACB' 1 8 1 '3D HNCO' 1 9 1 '3D HN(CA)CO' 1 10 2 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;350-750 uM [U-99% 13C; U-99% 15N] RNF126, 350-750 uM ZINC ION, 10 mM potassium phosphate, 100 mM sodium chloride, 250 uM TCEP, 10 uM DSS, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;350-750 uM [U-99% 13C; U-99% 15N] RNF126, 350-750 uM ZINC ION, 10 mM potassium phosphate, 100 mM sodium chloride, 250 uM TCEP, 10 uM DSS, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker AVANCE 1 'Bruker Avance' 500 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2N9O _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'Refinement in water with default parametres' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N9O _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N9O _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 3.2 1 'Bruker Biospin' processing TopSpin 3.2 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw ? 4 CCPN 'peak picking' 'CcpNmr Analysis' 2.3 5 CCPN 'chemical shift assignment' 'CcpNmr Analysis' 2.3 6 CCPN 'structure solution' 'CcpNmr Analysis' 2.3 7 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.1 8 ;Linge, O'Donoghue and Nilges ; refinement ARIA 2.1 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N9O _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N9O _struct.title 'Solution structure of RNF126 N-terminal zinc finger domain' _struct.pdbx_model_details 'lowest energy, model3' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N9O _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text 'Zinc finger, E3 ligase, LIGASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 15 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 13 A ZN 101 1_555 ? ? ? ? ? ? ? 2.294 ? ? metalc2 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 16 A ZN 101 1_555 ? ? ? ? ? ? ? 2.292 ? ? metalc3 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 29 A ZN 101 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc4 metalc ? ? A CYS 34 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 32 A ZN 101 1_555 ? ? ? ? ? ? ? 2.291 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 20 ? ILE A 22 ? VAL A 18 ILE A 20 A 2 TYR A 13 ? CYS A 15 ? TYR A 11 CYS A 13 A 3 ILE A 39 ? GLU A 41 ? ILE A 37 GLU A 39 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 22 ? O ILE A 20 N TYR A 13 ? N TYR A 11 A 2 3 N PHE A 14 ? N PHE A 12 O GLU A 40 ? O GLU A 38 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 15 ? CYS A 13 . ? 1_555 ? 2 AC1 4 CYS A 18 ? CYS A 16 . ? 1_555 ? 3 AC1 4 CYS A 31 ? CYS A 29 . ? 1_555 ? 4 AC1 4 CYS A 34 ? CYS A 32 . ? 1_555 ? # _atom_sites.entry_id 2N9O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 -1 GLY GLY A . n A 1 2 SER 2 0 0 SER SER A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 ALA 4 2 2 ALA ALA A . n A 1 5 GLU 5 3 3 GLU GLU A . n A 1 6 ALA 6 4 4 ALA ALA A . n A 1 7 SER 7 5 5 SER SER A . n A 1 8 PRO 8 6 6 PRO PRO A . n A 1 9 HIS 9 7 7 HIS HIS A . n A 1 10 PRO 10 8 8 PRO PRO A . n A 1 11 GLY 11 9 9 GLY GLY A . n A 1 12 ARG 12 10 10 ARG ARG A . n A 1 13 TYR 13 11 11 TYR TYR A . n A 1 14 PHE 14 12 12 PHE PHE A . n A 1 15 CYS 15 13 13 CYS CYS A . n A 1 16 HIS 16 14 14 HIS HIS A . n A 1 17 CYS 17 15 15 CYS CYS A . n A 1 18 CYS 18 16 16 CYS CYS A . n A 1 19 SER 19 17 17 SER SER A . n A 1 20 VAL 20 18 18 VAL VAL A . n A 1 21 GLU 21 19 19 GLU GLU A . n A 1 22 ILE 22 20 20 ILE ILE A . n A 1 23 VAL 23 21 21 VAL VAL A . n A 1 24 PRO 24 22 22 PRO PRO A . n A 1 25 ARG 25 23 23 ARG ARG A . n A 1 26 LEU 26 24 24 LEU LEU A . n A 1 27 PRO 27 25 25 PRO PRO A . n A 1 28 ASP 28 26 26 ASP ASP A . n A 1 29 TYR 29 27 27 TYR TYR A . n A 1 30 ILE 30 28 28 ILE ILE A . n A 1 31 CYS 31 29 29 CYS CYS A . n A 1 32 PRO 32 30 30 PRO PRO A . n A 1 33 ARG 33 31 31 ARG ARG A . n A 1 34 CYS 34 32 32 CYS CYS A . n A 1 35 GLU 35 33 33 GLU GLU A . n A 1 36 SER 36 34 34 SER SER A . n A 1 37 GLY 37 35 35 GLY GLY A . n A 1 38 PHE 38 36 36 PHE PHE A . n A 1 39 ILE 39 37 37 ILE ILE A . n A 1 40 GLU 40 38 38 GLU GLU A . n A 1 41 GLU 41 39 39 GLU GLU A . n A 1 42 LEU 42 40 40 LEU LEU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 15 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 18 ? A CYS 16 ? 1_555 110.2 ? 2 SG ? A CYS 15 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 31 ? A CYS 29 ? 1_555 108.8 ? 3 SG ? A CYS 18 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 31 ? A CYS 29 ? 1_555 111.1 ? 4 SG ? A CYS 15 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 34 ? A CYS 32 ? 1_555 109.2 ? 5 SG ? A CYS 18 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 34 ? A CYS 32 ? 1_555 110.9 ? 6 SG ? A CYS 31 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 34 ? A CYS 32 ? 1_555 106.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-05-25 2 'Structure model' 1 1 2016-06-01 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.value' 11 3 'Structure model' '_struct_conn.pdbx_dist_value' 12 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 13 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 14 3 'Structure model' '_struct_ref_seq_dif.details' 15 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 16 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 17 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity_1-1 ? 350-750 uM '[U-99% 13C; U-99% 15N]' 1 'ZINC ION-2' ? 350-750 uM ? 1 'potassium phosphate-3' 10 ? mM ? 1 'sodium chloride-4' 100 ? mM ? 1 TCEP-5 250 ? uM ? 1 DSS-6 10 ? uM ? 1 entity_1-7 ? 350-750 uM '[U-99% 13C; U-99% 15N]' 2 'ZINC ION-8' ? 350-750 uM ? 2 'potassium phosphate-9' 10 ? mM ? 2 'sodium chloride-10' 100 ? mM ? 2 TCEP-11 250 ? uM ? 2 DSS-12 10 ? uM ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 3 ? ? 69.44 -80.13 2 1 ALA A 4 ? ? 62.95 -172.74 3 1 PRO A 6 ? ? -76.32 47.54 4 1 PHE A 36 ? ? -67.20 85.22 5 2 SER A 5 ? ? 62.21 83.71 6 2 PHE A 36 ? ? -67.28 84.13 7 3 MET A 1 ? ? 67.96 -82.54 8 4 HIS A 7 ? ? 72.15 140.77 9 4 ILE A 28 ? ? -109.37 -168.58 10 4 PHE A 36 ? ? -68.48 86.05 11 5 ALA A 4 ? ? -148.48 -42.68 12 6 PRO A 6 ? ? -62.52 84.46 13 6 PHE A 36 ? ? -67.83 82.10 14 7 SER A 0 ? ? 64.11 -88.90 15 8 ALA A 2 ? ? -163.13 -38.88 16 8 SER A 5 ? ? 71.04 129.00 17 8 PRO A 6 ? ? -77.78 34.71 18 8 HIS A 7 ? ? 68.57 125.83 19 8 PHE A 36 ? ? -69.77 90.01 20 9 GLU A 3 ? ? 71.59 119.29 21 9 HIS A 7 ? ? 70.43 133.17 22 10 ALA A 4 ? ? -139.34 -45.50 23 10 ARG A 23 ? ? -69.97 99.48 24 11 SER A 0 ? ? 50.04 78.58 25 11 MET A 1 ? ? -79.88 48.92 26 11 ARG A 31 ? ? -98.47 -60.70 27 11 PHE A 36 ? ? -68.55 85.41 28 12 GLU A 3 ? ? -150.19 -65.97 29 12 ALA A 4 ? ? 62.49 -86.01 30 12 PHE A 36 ? ? -68.01 85.33 31 13 MET A 1 ? ? 70.39 -66.98 32 13 ALA A 2 ? ? -99.41 45.62 33 13 ALA A 4 ? ? -93.49 32.95 34 13 PHE A 36 ? ? -69.00 82.80 35 14 MET A 1 ? ? -92.98 -60.35 36 14 ALA A 4 ? ? 62.03 -178.44 37 14 HIS A 7 ? ? -170.80 126.76 38 14 PHE A 36 ? ? -68.92 82.95 39 15 MET A 1 ? ? 59.08 74.65 40 16 ALA A 2 ? ? -158.70 59.51 41 16 GLU A 3 ? ? 73.23 -63.28 42 16 SER A 5 ? ? 64.14 93.52 43 16 PRO A 6 ? ? -74.03 -164.33 44 16 ILE A 28 ? ? -115.41 -169.07 45 17 ALA A 2 ? ? -140.85 33.23 46 17 GLU A 3 ? ? -98.22 -83.83 47 17 ALA A 4 ? ? -159.16 -51.12 48 17 SER A 5 ? ? -170.73 74.90 49 18 ALA A 2 ? ? -171.82 -62.12 50 18 GLU A 3 ? ? -170.52 -100.04 51 18 SER A 5 ? ? -172.59 -59.00 52 18 ILE A 28 ? ? -112.66 -169.44 53 19 ALA A 4 ? ? 65.66 -81.52 54 19 SER A 5 ? ? -133.90 -58.00 55 19 PHE A 36 ? ? -68.47 86.37 56 20 PRO A 8 ? ? -75.37 -71.34 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #