data_2NB7 # _entry.id 2NB7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104649 RCSB ? ? 2NB7 PDB pdb_00002nb7 10.2210/pdb2nb7/pdb 25965 BMRB ? 10.13018/BMR25965 D_1000104649 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-02-17 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_spectrometer 4 2 'Structure model' struct_ref_seq_dif 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' 5 2 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2NB7 _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2016-01-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25965 BMRB unspecified . 2NB8 PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, Y.' 1 'To, J.' 2 'Surya, W.' 3 'Torres, J.' 4 # _citation.id primary _citation.title 'Inhibition of the human respiratory syncytial virus small hydrophobic protein and structural variations in a bicelle environment.' _citation.journal_abbrev J.Virol. _citation.journal_volume 88 _citation.page_first 11899 _citation.page_last 11914 _citation.year 2014 _citation.journal_id_ASTM JOVIAM _citation.country US _citation.journal_id_ISSN 0022-538X _citation.journal_id_CSD 0825 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25100835 _citation.pdbx_database_id_DOI 10.1128/JVI.00839-14 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, Y.' 1 ? primary 'To, J.' 2 ? primary 'Verdia-Baguena, C.' 3 ? primary 'Dossena, S.' 4 ? primary 'Surya, W.' 5 ? primary 'Huang, M.' 6 ? primary 'Paulmichl, M.' 7 ? primary 'Liu, D.X.' 8 ? primary 'Aguilella, V.M.' 9 ? primary 'Torres, J.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Small hydrophobic protein' _entity.formula_weight 1907.084 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP RESIDUES 1-14' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Small protein 1A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SNAMENTSITIEFSSKF _entity_poly.pdbx_seq_one_letter_code_can SNAMENTSITIEFSSKF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MET n 1 5 GLU n 1 6 ASN n 1 7 THR n 1 8 SER n 1 9 ILE n 1 10 THR n 1 11 ILE n 1 12 GLU n 1 13 PHE n 1 14 SER n 1 15 SER n 1 16 LYS n 1 17 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HRSV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SH, 1A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain A2 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human respiratory syncytial virus A2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11259 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pTBMalE _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 ? ? ? A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 GLU 5 2 2 GLU GLU A . n A 1 6 ASN 6 3 3 ASN ASN A . n A 1 7 THR 7 4 4 THR THR A . n A 1 8 SER 8 5 5 SER SER A . n A 1 9 ILE 9 6 6 ILE ILE A . n A 1 10 THR 10 7 7 THR THR A . n A 1 11 ILE 11 8 8 ILE ILE A . n A 1 12 GLU 12 9 9 GLU GLU A . n A 1 13 PHE 13 10 10 PHE PHE A . n A 1 14 SER 14 11 11 SER SER A . n A 1 15 SER 15 12 12 SER SER A . n A 1 16 LYS 16 13 13 LYS LYS A . n A 1 17 PHE 17 14 14 PHE PHE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2NB7 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2NB7 _struct.title 'Solution structure of N-terminal extramembrane domain of SH protein' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2NB7 _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'Bicelles, Small Hydrophobic Protein, viroporin, VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SH_HRSVA _struct_ref.pdbx_db_accession P04852 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MENTSITIEFSSKFWPYFTLIHMITTIISLLIIISIMIAILNKLCEYNVFHNKTFELPRARVNT _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2NB7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 17 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04852 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 14 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 14 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2NB7 SER A 1 ? UNP P04852 ? ? 'expression tag' -2 1 1 2NB7 ASN A 2 ? UNP P04852 ? ? 'expression tag' -1 2 1 2NB7 ALA A 3 ? UNP P04852 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 8 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 17 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 5 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 14 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -142.39 -54.20 2 2 SER A 5 ? ? -147.70 -53.71 3 3 SER A 5 ? ? -157.55 -54.10 4 4 SER A 5 ? ? -142.30 -56.38 5 5 SER A 5 ? ? -143.11 -54.55 6 6 SER A 5 ? ? -141.75 -59.46 7 7 SER A 5 ? ? -162.08 -56.53 8 8 SER A 5 ? ? -154.27 -56.43 9 9 THR A 4 ? ? -107.60 68.07 10 9 SER A 5 ? ? -152.25 -52.57 11 10 SER A 5 ? ? -142.87 -55.46 12 11 SER A 5 ? ? -143.88 -54.47 13 12 THR A 4 ? ? -113.09 68.81 14 12 SER A 5 ? ? -159.41 -52.77 15 13 SER A 5 ? ? -142.90 -53.60 16 14 SER A 5 ? ? -148.05 -54.09 17 15 SER A 5 ? ? -139.11 -59.16 18 16 SER A 5 ? ? -144.73 -54.00 19 17 THR A 4 ? ? -117.47 68.66 20 17 SER A 5 ? ? -175.74 -46.41 21 18 SER A 5 ? ? -157.80 -44.32 22 19 SER A 5 ? ? -148.88 -47.34 23 20 SER A 5 ? ? -145.48 -55.12 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2NB7 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2NB7 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents ;10 % [U-2H] D2O-1, 0.7 mM [U-13C; U-15N] entity-2, 9.5 % DHPC-DLPC-3, 20 mM sodium phosphate-4, 50 mM sodium chloride-5, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id D2O-1 10 ? % '[U-2H]' 1 entity-2 0.7 ? mM '[U-13C; U-15N]' 1 DHPC-DLPC-3 9.5 ? % ? 1 'sodium phosphate-4' 20 ? mM ? 1 'sodium chloride-5' 50 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 70 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D HNCA' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HNCO' 1 6 1 '3D HN(CA)CO' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2NB7 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Bruker Biospin, Keller, Guntert, Mumenthaler and Wuthrich' processing CYANA 1 ? 'Bruker Biospin, Keller, Guntert, Mumenthaler and Wuthrich' 'chemical shift assignment' CYANA 2 ? 'Bruker Biospin, Keller, Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3 ? ? refinement CYANA 4 ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A ALA 0 ? A ALA 3 4 2 Y 1 A SER -2 ? A SER 1 5 2 Y 1 A ASN -1 ? A ASN 2 6 2 Y 1 A ALA 0 ? A ALA 3 7 3 Y 1 A SER -2 ? A SER 1 8 3 Y 1 A ASN -1 ? A ASN 2 9 3 Y 1 A ALA 0 ? A ALA 3 10 4 Y 1 A SER -2 ? A SER 1 11 4 Y 1 A ASN -1 ? A ASN 2 12 4 Y 1 A ALA 0 ? A ALA 3 13 5 Y 1 A SER -2 ? A SER 1 14 5 Y 1 A ASN -1 ? A ASN 2 15 5 Y 1 A ALA 0 ? A ALA 3 16 6 Y 1 A SER -2 ? A SER 1 17 6 Y 1 A ASN -1 ? A ASN 2 18 6 Y 1 A ALA 0 ? A ALA 3 19 7 Y 1 A SER -2 ? A SER 1 20 7 Y 1 A ASN -1 ? A ASN 2 21 7 Y 1 A ALA 0 ? A ALA 3 22 8 Y 1 A SER -2 ? A SER 1 23 8 Y 1 A ASN -1 ? A ASN 2 24 8 Y 1 A ALA 0 ? A ALA 3 25 9 Y 1 A SER -2 ? A SER 1 26 9 Y 1 A ASN -1 ? A ASN 2 27 9 Y 1 A ALA 0 ? A ALA 3 28 10 Y 1 A SER -2 ? A SER 1 29 10 Y 1 A ASN -1 ? A ASN 2 30 10 Y 1 A ALA 0 ? A ALA 3 31 11 Y 1 A SER -2 ? A SER 1 32 11 Y 1 A ASN -1 ? A ASN 2 33 11 Y 1 A ALA 0 ? A ALA 3 34 12 Y 1 A SER -2 ? A SER 1 35 12 Y 1 A ASN -1 ? A ASN 2 36 12 Y 1 A ALA 0 ? A ALA 3 37 13 Y 1 A SER -2 ? A SER 1 38 13 Y 1 A ASN -1 ? A ASN 2 39 13 Y 1 A ALA 0 ? A ALA 3 40 14 Y 1 A SER -2 ? A SER 1 41 14 Y 1 A ASN -1 ? A ASN 2 42 14 Y 1 A ALA 0 ? A ALA 3 43 15 Y 1 A SER -2 ? A SER 1 44 15 Y 1 A ASN -1 ? A ASN 2 45 15 Y 1 A ALA 0 ? A ALA 3 46 16 Y 1 A SER -2 ? A SER 1 47 16 Y 1 A ASN -1 ? A ASN 2 48 16 Y 1 A ALA 0 ? A ALA 3 49 17 Y 1 A SER -2 ? A SER 1 50 17 Y 1 A ASN -1 ? A ASN 2 51 17 Y 1 A ALA 0 ? A ALA 3 52 18 Y 1 A SER -2 ? A SER 1 53 18 Y 1 A ASN -1 ? A ASN 2 54 18 Y 1 A ALA 0 ? A ALA 3 55 19 Y 1 A SER -2 ? A SER 1 56 19 Y 1 A ASN -1 ? A ASN 2 57 19 Y 1 A ALA 0 ? A ALA 3 58 20 Y 1 A SER -2 ? A SER 1 59 20 Y 1 A ASN -1 ? A ASN 2 60 20 Y 1 A ALA 0 ? A ALA 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 GLU N N N N 31 GLU CA C N S 32 GLU C C N N 33 GLU O O N N 34 GLU CB C N N 35 GLU CG C N N 36 GLU CD C N N 37 GLU OE1 O N N 38 GLU OE2 O N N 39 GLU OXT O N N 40 GLU H H N N 41 GLU H2 H N N 42 GLU HA H N N 43 GLU HB2 H N N 44 GLU HB3 H N N 45 GLU HG2 H N N 46 GLU HG3 H N N 47 GLU HE2 H N N 48 GLU HXT H N N 49 ILE N N N N 50 ILE CA C N S 51 ILE C C N N 52 ILE O O N N 53 ILE CB C N S 54 ILE CG1 C N N 55 ILE CG2 C N N 56 ILE CD1 C N N 57 ILE OXT O N N 58 ILE H H N N 59 ILE H2 H N N 60 ILE HA H N N 61 ILE HB H N N 62 ILE HG12 H N N 63 ILE HG13 H N N 64 ILE HG21 H N N 65 ILE HG22 H N N 66 ILE HG23 H N N 67 ILE HD11 H N N 68 ILE HD12 H N N 69 ILE HD13 H N N 70 ILE HXT H N N 71 LYS N N N N 72 LYS CA C N S 73 LYS C C N N 74 LYS O O N N 75 LYS CB C N N 76 LYS CG C N N 77 LYS CD C N N 78 LYS CE C N N 79 LYS NZ N N N 80 LYS OXT O N N 81 LYS H H N N 82 LYS H2 H N N 83 LYS HA H N N 84 LYS HB2 H N N 85 LYS HB3 H N N 86 LYS HG2 H N N 87 LYS HG3 H N N 88 LYS HD2 H N N 89 LYS HD3 H N N 90 LYS HE2 H N N 91 LYS HE3 H N N 92 LYS HZ1 H N N 93 LYS HZ2 H N N 94 LYS HZ3 H N N 95 LYS HXT H N N 96 MET N N N N 97 MET CA C N S 98 MET C C N N 99 MET O O N N 100 MET CB C N N 101 MET CG C N N 102 MET SD S N N 103 MET CE C N N 104 MET OXT O N N 105 MET H H N N 106 MET H2 H N N 107 MET HA H N N 108 MET HB2 H N N 109 MET HB3 H N N 110 MET HG2 H N N 111 MET HG3 H N N 112 MET HE1 H N N 113 MET HE2 H N N 114 MET HE3 H N N 115 MET HXT H N N 116 PHE N N N N 117 PHE CA C N S 118 PHE C C N N 119 PHE O O N N 120 PHE CB C N N 121 PHE CG C Y N 122 PHE CD1 C Y N 123 PHE CD2 C Y N 124 PHE CE1 C Y N 125 PHE CE2 C Y N 126 PHE CZ C Y N 127 PHE OXT O N N 128 PHE H H N N 129 PHE H2 H N N 130 PHE HA H N N 131 PHE HB2 H N N 132 PHE HB3 H N N 133 PHE HD1 H N N 134 PHE HD2 H N N 135 PHE HE1 H N N 136 PHE HE2 H N N 137 PHE HZ H N N 138 PHE HXT H N N 139 SER N N N N 140 SER CA C N S 141 SER C C N N 142 SER O O N N 143 SER CB C N N 144 SER OG O N N 145 SER OXT O N N 146 SER H H N N 147 SER H2 H N N 148 SER HA H N N 149 SER HB2 H N N 150 SER HB3 H N N 151 SER HG H N N 152 SER HXT H N N 153 THR N N N N 154 THR CA C N S 155 THR C C N N 156 THR O O N N 157 THR CB C N R 158 THR OG1 O N N 159 THR CG2 C N N 160 THR OXT O N N 161 THR H H N N 162 THR H2 H N N 163 THR HA H N N 164 THR HB H N N 165 THR HG1 H N N 166 THR HG21 H N N 167 THR HG22 H N N 168 THR HG23 H N N 169 THR HXT H N N 170 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 GLU N CA sing N N 29 GLU N H sing N N 30 GLU N H2 sing N N 31 GLU CA C sing N N 32 GLU CA CB sing N N 33 GLU CA HA sing N N 34 GLU C O doub N N 35 GLU C OXT sing N N 36 GLU CB CG sing N N 37 GLU CB HB2 sing N N 38 GLU CB HB3 sing N N 39 GLU CG CD sing N N 40 GLU CG HG2 sing N N 41 GLU CG HG3 sing N N 42 GLU CD OE1 doub N N 43 GLU CD OE2 sing N N 44 GLU OE2 HE2 sing N N 45 GLU OXT HXT sing N N 46 ILE N CA sing N N 47 ILE N H sing N N 48 ILE N H2 sing N N 49 ILE CA C sing N N 50 ILE CA CB sing N N 51 ILE CA HA sing N N 52 ILE C O doub N N 53 ILE C OXT sing N N 54 ILE CB CG1 sing N N 55 ILE CB CG2 sing N N 56 ILE CB HB sing N N 57 ILE CG1 CD1 sing N N 58 ILE CG1 HG12 sing N N 59 ILE CG1 HG13 sing N N 60 ILE CG2 HG21 sing N N 61 ILE CG2 HG22 sing N N 62 ILE CG2 HG23 sing N N 63 ILE CD1 HD11 sing N N 64 ILE CD1 HD12 sing N N 65 ILE CD1 HD13 sing N N 66 ILE OXT HXT sing N N 67 LYS N CA sing N N 68 LYS N H sing N N 69 LYS N H2 sing N N 70 LYS CA C sing N N 71 LYS CA CB sing N N 72 LYS CA HA sing N N 73 LYS C O doub N N 74 LYS C OXT sing N N 75 LYS CB CG sing N N 76 LYS CB HB2 sing N N 77 LYS CB HB3 sing N N 78 LYS CG CD sing N N 79 LYS CG HG2 sing N N 80 LYS CG HG3 sing N N 81 LYS CD CE sing N N 82 LYS CD HD2 sing N N 83 LYS CD HD3 sing N N 84 LYS CE NZ sing N N 85 LYS CE HE2 sing N N 86 LYS CE HE3 sing N N 87 LYS NZ HZ1 sing N N 88 LYS NZ HZ2 sing N N 89 LYS NZ HZ3 sing N N 90 LYS OXT HXT sing N N 91 MET N CA sing N N 92 MET N H sing N N 93 MET N H2 sing N N 94 MET CA C sing N N 95 MET CA CB sing N N 96 MET CA HA sing N N 97 MET C O doub N N 98 MET C OXT sing N N 99 MET CB CG sing N N 100 MET CB HB2 sing N N 101 MET CB HB3 sing N N 102 MET CG SD sing N N 103 MET CG HG2 sing N N 104 MET CG HG3 sing N N 105 MET SD CE sing N N 106 MET CE HE1 sing N N 107 MET CE HE2 sing N N 108 MET CE HE3 sing N N 109 MET OXT HXT sing N N 110 PHE N CA sing N N 111 PHE N H sing N N 112 PHE N H2 sing N N 113 PHE CA C sing N N 114 PHE CA CB sing N N 115 PHE CA HA sing N N 116 PHE C O doub N N 117 PHE C OXT sing N N 118 PHE CB CG sing N N 119 PHE CB HB2 sing N N 120 PHE CB HB3 sing N N 121 PHE CG CD1 doub Y N 122 PHE CG CD2 sing Y N 123 PHE CD1 CE1 sing Y N 124 PHE CD1 HD1 sing N N 125 PHE CD2 CE2 doub Y N 126 PHE CD2 HD2 sing N N 127 PHE CE1 CZ doub Y N 128 PHE CE1 HE1 sing N N 129 PHE CE2 CZ sing Y N 130 PHE CE2 HE2 sing N N 131 PHE CZ HZ sing N N 132 PHE OXT HXT sing N N 133 SER N CA sing N N 134 SER N H sing N N 135 SER N H2 sing N N 136 SER CA C sing N N 137 SER CA CB sing N N 138 SER CA HA sing N N 139 SER C O doub N N 140 SER C OXT sing N N 141 SER CB OG sing N N 142 SER CB HB2 sing N N 143 SER CB HB3 sing N N 144 SER OG HG sing N N 145 SER OXT HXT sing N N 146 THR N CA sing N N 147 THR N H sing N N 148 THR N H2 sing N N 149 THR CA C sing N N 150 THR CA CB sing N N 151 THR CA HA sing N N 152 THR C O doub N N 153 THR C OXT sing N N 154 THR CB OG1 sing N N 155 THR CB CG2 sing N N 156 THR CB HB sing N N 157 THR OG1 HG1 sing N N 158 THR CG2 HG21 sing N N 159 THR CG2 HG22 sing N N 160 THR CG2 HG23 sing N N 161 THR OXT HXT sing N N 162 # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2NB7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #