data_2NBD # _entry.id 2NBD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id RCSB104655 RCSB 2NBD PDB 25972 BMRB D_1000104655 WWPDB # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25972 BMRB unspecified . 2NBE PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2NBD _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2016-02-04 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Surana, P.' 1 'Das, R.' 2 # _citation.id primary _citation.title 'Observing a late folding intermediate of Ubiquitin at atomic resolution by NMR' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 25 _citation.page_first 1438 _citation.page_last 1450 _citation.year 2016 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27111887 _citation.pdbx_database_id_DOI 10.1002/pro.2940 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Surana, P.' 1 primary 'Das, R.' 2 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description entity _entity.formula_weight 8548.778 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation V26A _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MQIFVKTLTGKTITLEVEPSDTIENAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG _entity_poly.pdbx_seq_one_letter_code_can MQIFVKTLTGKTITLEVEPSDTIENAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 ILE n 1 4 PHE n 1 5 VAL n 1 6 LYS n 1 7 THR n 1 8 LEU n 1 9 THR n 1 10 GLY n 1 11 LYS n 1 12 THR n 1 13 ILE n 1 14 THR n 1 15 LEU n 1 16 GLU n 1 17 VAL n 1 18 GLU n 1 19 PRO n 1 20 SER n 1 21 ASP n 1 22 THR n 1 23 ILE n 1 24 GLU n 1 25 ASN n 1 26 ALA n 1 27 LYS n 1 28 ALA n 1 29 LYS n 1 30 ILE n 1 31 GLN n 1 32 ASP n 1 33 LYS n 1 34 GLU n 1 35 GLY n 1 36 ILE n 1 37 PRO n 1 38 PRO n 1 39 ASP n 1 40 GLN n 1 41 GLN n 1 42 ARG n 1 43 LEU n 1 44 ILE n 1 45 PHE n 1 46 ALA n 1 47 GLY n 1 48 LYS n 1 49 GLN n 1 50 LEU n 1 51 GLU n 1 52 ASP n 1 53 GLY n 1 54 ARG n 1 55 THR n 1 56 LEU n 1 57 SER n 1 58 ASP n 1 59 TYR n 1 60 ASN n 1 61 ILE n 1 62 GLN n 1 63 LYS n 1 64 GLU n 1 65 SER n 1 66 THR n 1 67 LEU n 1 68 HIS n 1 69 LEU n 1 70 VAL n 1 71 LEU n 1 72 ARG n 1 73 LEU n 1 74 ARG n 1 75 GLY n 1 76 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pGL _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2NBD _struct_ref.pdbx_db_accession 2NBD _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2NBD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 76 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2NBD _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HNCA' 1 4 1 '3D HNCACB' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D C(CO)NH' 1 7 1 '3D H(CCO)NH' 1 8 1 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-13C; U-15N] Ubiquitin-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2NBD _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2NBD _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2NBD _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version Goddard 'chemical shift assignment' sparky 1 3.115 ? refinement NIHxplor 2 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Solution structure of V26A mutant of Ubiquitin at pH 6.0' _exptl.entry_id 2NBD _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2NBD _struct.title 'Solution structure of V26A mutant of Ubiquitin at pH 6.0' _struct.pdbx_descriptor entity _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2NBD _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Ubiquitin, mutant, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 23 ? GLU A 34 ? ILE A 23 GLU A 34 1 ? 12 HELX_P HELX_P2 2 PRO A 38 ? GLN A 40 ? PRO A 38 GLN A 40 1 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details 1 ? 1 ? 2 ? 1 ? 3 ? 1 ? 4 ? 1 ? # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id 1 1 ILE A 3 ? LYS A 6 ? ILE A 3 LYS A 6 2 1 THR A 12 ? LEU A 15 ? THR A 12 LEU A 15 3 1 GLN A 41 ? ILE A 44 ? GLN A 41 ILE A 44 4 1 THR A 66 ? LEU A 71 ? THR A 66 LEU A 71 # _atom_sites.entry_id 2NBD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 GLY 76 76 76 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-05-18 2 'Structure model' 1 1 2016-09-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_nmr_exptl_sample.component Ubiquitin-1 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 7 HG1 A THR 55 ? ? HG A SER 57 ? ? 1.32 2 12 H A GLN 62 ? ? HG A SER 65 ? ? 1.33 3 13 HZ1 A LYS 6 ? ? HG1 A THR 12 ? ? 1.34 4 17 HE A ARG 42 ? ? HE A ARG 72 ? ? 1.26 5 18 HG1 A THR 7 ? ? HG1 A THR 9 ? ? 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 21 ? ? -80.53 48.14 2 1 ILE A 23 ? ? -30.16 -30.83 3 1 PRO A 38 ? ? -42.36 -16.18 4 1 ALA A 46 ? ? 71.47 39.00 5 1 SER A 65 ? ? -47.88 162.93 6 1 LEU A 73 ? ? -167.85 86.93 7 2 PRO A 19 ? ? -29.66 -40.03 8 2 ASP A 21 ? ? -81.56 48.05 9 2 ILE A 23 ? ? -26.16 -40.38 10 2 SER A 65 ? ? -49.48 164.50 11 2 LEU A 73 ? ? -170.43 96.07 12 3 ASP A 21 ? ? -80.78 48.50 13 3 ILE A 23 ? ? -30.79 -30.32 14 3 PRO A 38 ? ? -42.68 -16.00 15 3 SER A 65 ? ? -48.19 166.16 16 4 ASP A 21 ? ? -80.70 48.08 17 4 ILE A 23 ? ? -26.40 -39.51 18 4 PRO A 38 ? ? -42.51 -15.82 19 4 SER A 65 ? ? -45.25 153.79 20 4 LEU A 73 ? ? -169.61 70.51 21 5 PRO A 19 ? ? -32.89 -39.32 22 5 ASP A 21 ? ? -81.37 48.06 23 5 ILE A 23 ? ? -25.97 -39.80 24 5 LEU A 73 ? ? -167.51 98.76 25 6 PRO A 19 ? ? -45.78 -1.61 26 6 ASP A 21 ? ? -81.22 48.45 27 6 ILE A 23 ? ? -27.09 -36.87 28 6 LEU A 73 ? ? -166.77 105.27 29 7 PRO A 19 ? ? -30.60 -38.89 30 7 ASP A 21 ? ? -82.52 48.31 31 7 ILE A 23 ? ? -25.82 -41.75 32 7 LEU A 73 ? ? -160.59 102.16 33 8 ASP A 21 ? ? -80.43 48.55 34 8 ILE A 23 ? ? -25.70 -41.68 35 8 PRO A 37 ? ? -43.63 153.47 36 9 PRO A 19 ? ? -36.89 -38.36 37 9 ASP A 21 ? ? -80.74 48.57 38 9 ILE A 23 ? ? -25.63 -42.37 39 9 PRO A 37 ? ? -44.89 153.39 40 9 LEU A 73 ? ? -172.27 108.62 41 10 ASP A 21 ? ? -80.69 48.32 42 10 ILE A 23 ? ? -25.76 -41.72 43 10 PRO A 38 ? ? -42.55 -17.84 44 10 LEU A 73 ? ? 56.19 113.11 45 11 GLN A 2 ? ? -48.07 158.01 46 11 PRO A 19 ? ? -32.32 -37.70 47 11 ASP A 21 ? ? -81.46 48.43 48 11 ILE A 23 ? ? -24.82 -39.96 49 11 SER A 65 ? ? -32.36 127.43 50 12 GLN A 2 ? ? -45.79 159.95 51 12 PRO A 19 ? ? -29.78 -41.18 52 12 ASP A 21 ? ? -81.66 48.22 53 12 ILE A 23 ? ? -25.07 -39.88 54 12 PRO A 38 ? ? -42.44 -17.86 55 12 ALA A 46 ? ? 55.78 18.85 56 12 SER A 65 ? ? -37.68 134.47 57 12 LEU A 73 ? ? -174.19 122.34 58 13 ASP A 21 ? ? -80.94 48.73 59 13 ILE A 23 ? ? -25.03 -38.98 60 13 PRO A 37 ? ? -44.23 152.19 61 13 LEU A 73 ? ? -168.38 54.52 62 14 GLN A 2 ? ? 64.87 82.82 63 14 ASP A 21 ? ? -80.71 48.62 64 14 ILE A 23 ? ? -30.10 -30.12 65 14 PRO A 38 ? ? -44.20 -16.33 66 14 SER A 65 ? ? -47.79 163.07 67 15 PRO A 19 ? ? -29.02 -39.40 68 15 ASP A 21 ? ? -82.09 48.11 69 15 ILE A 23 ? ? -30.58 -30.42 70 15 PRO A 38 ? ? -42.10 -16.87 71 15 SER A 65 ? ? -49.53 156.95 72 15 LEU A 73 ? ? 56.73 97.27 73 16 GLN A 2 ? ? 81.47 80.70 74 16 ASP A 21 ? ? -80.70 48.24 75 16 ILE A 23 ? ? -29.73 -31.34 76 16 PRO A 38 ? ? -44.36 -12.77 77 16 SER A 65 ? ? -44.41 154.17 78 17 ASP A 21 ? ? -80.45 48.48 79 17 ILE A 23 ? ? -30.45 -30.90 80 17 PRO A 37 ? ? -44.66 152.35 81 17 LEU A 73 ? ? 61.94 107.51 82 18 GLN A 2 ? ? -171.10 148.70 83 18 PRO A 19 ? ? -35.13 -38.82 84 18 ASP A 21 ? ? -80.93 48.56 85 18 ILE A 23 ? ? -25.75 -39.41 86 18 PRO A 38 ? ? -43.44 -14.26 87 19 ASP A 21 ? ? -80.92 48.91 88 19 ILE A 23 ? ? -24.23 -40.66 89 19 ALA A 46 ? ? 70.09 32.48 90 19 SER A 65 ? ? -37.98 135.02 91 20 ASP A 21 ? ? -80.55 48.45 92 20 ILE A 23 ? ? -31.04 -30.30 93 20 PRO A 38 ? ? -42.61 -16.15 94 20 PHE A 45 ? ? -102.10 -108.27 95 20 ALA A 46 ? ? -62.58 69.29 96 20 SER A 65 ? ? -50.47 171.12 97 20 LEU A 73 ? ? -162.36 101.36 #