data_2NBR # _entry.id 2NBR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104669 RCSB ? ? 2NBR PDB pdb_00002nbr 10.2210/pdb2nbr/pdb 25993 BMRB ? ? D_1000104669 WWPDB ? ? # _pdbx_database_related.db_id 25993 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2NBR _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2016-03-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dixit, K.' 1 'Pande, A.' 2 'Pande, J.' 3 'Sarma, S.P.' 4 # _citation.id primary _citation.title ;Nuclear Magnetic Resonance Structure of a Major Lens Protein, Human gamma C-Crystallin: Role of the Dipole Moment in Protein Solubility. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 55 _citation.page_first 3136 _citation.page_last 3149 _citation.year 2016 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 1520-4995 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27187112 _citation.pdbx_database_id_DOI 10.1021/acs.biochem.6b00359 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dixit, K.' 1 ? primary 'Pande, A.' 2 ? primary 'Pande, J.' 3 ? primary 'Sarma, S.P.' 4 ? # _cell.entry_id 2NBR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2NBR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Gamma-crystallin C' _entity.formula_weight 20774.492 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gamma-C-crystallin, Gamma-crystallin 2-1, Gamma-crystallin 3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCL IPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMD AKAGSLRRVVDLY ; _entity_poly.pdbx_seq_one_letter_code_can ;GKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCL IPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMD AKAGSLRRVVDLY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LYS n 1 3 ILE n 1 4 THR n 1 5 PHE n 1 6 TYR n 1 7 GLU n 1 8 ASP n 1 9 ARG n 1 10 ALA n 1 11 PHE n 1 12 GLN n 1 13 GLY n 1 14 ARG n 1 15 SER n 1 16 TYR n 1 17 GLU n 1 18 THR n 1 19 THR n 1 20 THR n 1 21 ASP n 1 22 CYS n 1 23 PRO n 1 24 ASN n 1 25 LEU n 1 26 GLN n 1 27 PRO n 1 28 TYR n 1 29 PHE n 1 30 SER n 1 31 ARG n 1 32 CYS n 1 33 ASN n 1 34 SER n 1 35 ILE n 1 36 ARG n 1 37 VAL n 1 38 GLU n 1 39 SER n 1 40 GLY n 1 41 CYS n 1 42 TRP n 1 43 MET n 1 44 LEU n 1 45 TYR n 1 46 GLU n 1 47 ARG n 1 48 PRO n 1 49 ASN n 1 50 TYR n 1 51 GLN n 1 52 GLY n 1 53 GLN n 1 54 GLN n 1 55 TYR n 1 56 LEU n 1 57 LEU n 1 58 ARG n 1 59 ARG n 1 60 GLY n 1 61 GLU n 1 62 TYR n 1 63 PRO n 1 64 ASP n 1 65 TYR n 1 66 GLN n 1 67 GLN n 1 68 TRP n 1 69 MET n 1 70 GLY n 1 71 LEU n 1 72 SER n 1 73 ASP n 1 74 SER n 1 75 ILE n 1 76 ARG n 1 77 SER n 1 78 CYS n 1 79 CYS n 1 80 LEU n 1 81 ILE n 1 82 PRO n 1 83 GLN n 1 84 THR n 1 85 VAL n 1 86 SER n 1 87 HIS n 1 88 ARG n 1 89 LEU n 1 90 ARG n 1 91 LEU n 1 92 TYR n 1 93 GLU n 1 94 ARG n 1 95 GLU n 1 96 ASP n 1 97 HIS n 1 98 LYS n 1 99 GLY n 1 100 LEU n 1 101 MET n 1 102 MET n 1 103 GLU n 1 104 LEU n 1 105 SER n 1 106 GLU n 1 107 ASP n 1 108 CYS n 1 109 PRO n 1 110 SER n 1 111 ILE n 1 112 GLN n 1 113 ASP n 1 114 ARG n 1 115 PHE n 1 116 HIS n 1 117 LEU n 1 118 SER n 1 119 GLU n 1 120 ILE n 1 121 ARG n 1 122 SER n 1 123 LEU n 1 124 HIS n 1 125 VAL n 1 126 LEU n 1 127 GLU n 1 128 GLY n 1 129 CYS n 1 130 TRP n 1 131 VAL n 1 132 LEU n 1 133 TYR n 1 134 GLU n 1 135 LEU n 1 136 PRO n 1 137 ASN n 1 138 TYR n 1 139 ARG n 1 140 GLY n 1 141 ARG n 1 142 GLN n 1 143 TYR n 1 144 LEU n 1 145 LEU n 1 146 ARG n 1 147 PRO n 1 148 GLN n 1 149 GLU n 1 150 TYR n 1 151 ARG n 1 152 ARG n 1 153 CYS n 1 154 GLN n 1 155 ASP n 1 156 TRP n 1 157 GLY n 1 158 ALA n 1 159 MET n 1 160 ASP n 1 161 ALA n 1 162 LYS n 1 163 ALA n 1 164 GLY n 1 165 SER n 1 166 LEU n 1 167 ARG n 1 168 ARG n 1 169 VAL n 1 170 VAL n 1 171 ASP n 1 172 LEU n 1 173 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CRYGC, CRYG3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET3a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CRGC_HUMAN _struct_ref.pdbx_db_accession P07315 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCL IPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMD AKAGSLRRVVDLY ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2NBR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 173 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07315 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 174 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 173 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC/HMQC' 1 2 2 'Expt_10 (H{[N]+[HA]})' 1 3 1 '3D HNHB' 1 4 1 '3D HNCO' 1 5 1 '3D HNCACB' 1 6 1 'Expt_16 (H[N[co[{CA|ca[C]}]]])' 1 7 1 'Expt_21 (C_coNH.relayed)' 1 9 1 '3D H(CCO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.02 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5 mM [U-99% 13C; U-99% 15N] Molecule 1-1, 20 mM potassium phosphate-2, 5 mM DTT-3, 20 mM sodium chloride-4, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.5 mM [U-15N] Molecule 1-5, 20 mM potassium phosphate-6, 5 mM DTT-7, 20 mM sodium chloride-8, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '0.5 mM [U-99% 13C; U-99% 15N] Molecule 1-9, 20 mM potassium phosphate-10, 5 mM DTT-11, 20 mM sodium chloride-12, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Agilent DDS2 1 'Agilent DDS2' 700 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2NBR _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2NBR _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version CCPN 'chemical shift assignment' 'CcpNmr Analysis' 1 2.1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'spectrum display' NMRDraw 2 any 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'spectrum analysis' NMRDraw 3 any 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'spectrum processing' NMRPipe 4 any 'Johnson, One Moon Scientific, Guntert, Mumenthaler and Wuthrich' 'spectrum display' NMRView 5 any 'Johnson, One Moon Scientific, Guntert, Mumenthaler and Wuthrich' 'spectrum analysis' NMRView 6 any 'Johnson, One Moon Scientific, Guntert, Mumenthaler and Wuthrich' 'structure solution' NMRView 7 any 'Johnson, One Moon Scientific, Guntert, Mumenthaler and Wuthrich' 'spectrum display' NMRView 8 any 'Johnson, One Moon Scientific, Guntert, Mumenthaler and Wuthrich' 'spectrum analysis' NMRView 9 any 'Johnson, One Moon Scientific, Guntert, Mumenthaler and Wuthrich' 'structure solution' NMRView 10 any 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 11 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2NBR _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2NBR _struct.title 'The Solution Structure of Human gammaC-crystallin' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2NBR _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'Human gammaC-crystallin, STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 64 ? MET A 69 ? ASP A 64 MET A 69 5 ? 6 HELX_P HELX_P2 2 SER A 110 ? PHE A 115 ? SER A 110 PHE A 115 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? C ? 4 ? D ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 12 ? THR A 18 ? GLN A 12 THR A 18 A 2 ILE A 3 ? ASP A 8 ? ILE A 3 ASP A 8 A 3 SER A 34 ? VAL A 37 ? SER A 34 VAL A 37 A 4 GLY A 60 ? TYR A 62 ? GLY A 60 TYR A 62 B 1 GLN A 51 ? LEU A 57 ? GLN A 51 LEU A 57 B 2 CYS A 41 ? ARG A 47 ? CYS A 41 ARG A 47 B 3 SER A 77 ? ILE A 81 ? SER A 77 ILE A 81 C 1 LYS A 98 ? LEU A 104 ? LYS A 98 LEU A 104 C 2 ARG A 88 ? ARG A 94 ? ARG A 88 ARG A 94 C 3 SER A 122 ? GLU A 127 ? SER A 122 GLU A 127 C 4 GLU A 149 ? TYR A 150 ? GLU A 149 TYR A 150 D 1 ARG A 139 ? LEU A 145 ? ARG A 139 LEU A 145 D 2 TRP A 130 ? LEU A 135 ? TRP A 130 LEU A 135 D 3 SER A 165 ? ARG A 168 ? SER A 165 ARG A 168 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 16 ? O TYR A 16 N PHE A 5 ? N PHE A 5 A 2 3 N THR A 4 ? N THR A 4 O ARG A 36 ? O ARG A 36 A 3 4 N ILE A 35 ? N ILE A 35 O TYR A 62 ? O TYR A 62 B 1 2 O TYR A 55 ? O TYR A 55 N LEU A 44 ? N LEU A 44 B 2 3 N TYR A 45 ? N TYR A 45 O SER A 77 ? O SER A 77 C 1 2 O MET A 102 ? O MET A 102 N LEU A 91 ? N LEU A 91 C 2 3 N TYR A 92 ? N TYR A 92 O SER A 122 ? O SER A 122 C 3 4 N LEU A 123 ? N LEU A 123 O TYR A 150 ? O TYR A 150 D 1 2 O TYR A 143 ? O TYR A 143 N LEU A 132 ? N LEU A 132 D 2 3 N TYR A 133 ? N TYR A 133 O SER A 165 ? O SER A 165 # _atom_sites.entry_id 2NBR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 TRP 68 68 68 TRP TRP A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 CYS 129 129 129 CYS CYS A . n A 1 130 TRP 130 130 130 TRP TRP A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 TYR 143 143 143 TYR TYR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 CYS 153 153 153 CYS CYS A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 TRP 156 156 156 TRP TRP A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 MET 159 159 159 MET MET A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 TYR 173 173 173 TYR TYR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-01 2 'Structure model' 1 1 2017-06-07 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Molecule 1-1' 0.5 ? mM '[U-99% 13C; U-99% 15N]' 1 'potassium phosphate-2' 20 ? mM ? 1 DTT-3 5 ? mM ? 1 'sodium chloride-4' 20 ? mM ? 1 'Molecule 1-5' 0.5 ? mM '[U-15N]' 2 'potassium phosphate-6' 20 ? mM ? 2 DTT-7 5 ? mM ? 2 'sodium chloride-8' 20 ? mM ? 2 'Molecule 1-9' 0.5 ? mM '[U-99% 13C; U-99% 15N]' 3 'potassium phosphate-10' 20 ? mM ? 3 DTT-11 5 ? mM ? 3 'sodium chloride-12' 20 ? mM ? 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2NBR _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1960 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 594 _pdbx_nmr_constraints.NOE_long_range_total_count 589 _pdbx_nmr_constraints.NOE_medium_range_total_count 148 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 629 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 114 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 164 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 164 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 71 ? ? -98.61 -60.60 2 1 SER A 74 ? ? -53.86 99.19 3 1 HIS A 97 ? ? 61.21 60.97 4 1 SER A 110 ? ? -171.52 112.57 5 1 ARG A 114 ? ? -92.01 -80.51 6 1 PRO A 136 ? ? -59.87 173.86 7 1 PRO A 147 ? ? -62.49 87.85 8 1 ARG A 152 ? ? -172.37 -179.32 9 2 TYR A 28 ? ? -120.44 -59.20 10 2 ARG A 114 ? ? -94.29 -76.19 11 2 PRO A 136 ? ? -57.91 179.15 12 2 PRO A 147 ? ? -54.91 91.52 13 3 THR A 19 ? ? -141.32 31.39 14 3 ASP A 64 ? ? -171.47 -177.03 15 3 PRO A 82 ? ? -80.14 -155.36 16 3 ARG A 114 ? ? -96.27 -73.49 17 3 PRO A 136 ? ? -63.35 -177.70 18 3 PRO A 147 ? ? -61.66 85.90 19 4 ASP A 96 ? ? 65.94 60.29 20 4 PRO A 147 ? ? -57.93 94.63 21 5 PHE A 11 ? ? 60.93 60.76 22 5 THR A 19 ? ? -141.39 27.45 23 5 TYR A 28 ? ? -96.86 -60.36 24 5 LEU A 104 ? ? -161.23 114.15 25 5 SER A 110 ? ? -162.60 109.56 26 5 ARG A 114 ? ? -97.39 -77.29 27 5 PRO A 147 ? ? -58.49 98.13 28 5 GLN A 148 ? ? -171.49 -178.95 29 5 ARG A 152 ? ? -173.58 -179.18 30 6 ARG A 59 ? ? -59.87 106.89 31 6 HIS A 97 ? ? 65.88 60.23 32 6 ARG A 114 ? ? -93.25 -81.11 33 6 PRO A 147 ? ? -60.34 89.73 34 7 CYS A 22 ? ? -160.19 110.45 35 7 LEU A 104 ? ? -162.58 109.15 36 7 SER A 110 ? ? -163.23 101.72 37 7 ARG A 114 ? ? -90.94 -77.31 38 7 PRO A 147 ? ? -61.10 87.50 39 8 PHE A 11 ? ? 63.15 62.00 40 8 ARG A 114 ? ? -106.38 -79.91 41 8 PRO A 136 ? ? -67.72 -177.69 42 8 PRO A 147 ? ? -55.66 94.81 43 9 PHE A 11 ? ? 60.81 61.54 44 9 ARG A 114 ? ? -109.27 -73.47 45 9 PRO A 147 ? ? -54.88 88.84 46 9 GLN A 148 ? ? -172.82 -178.39 47 10 LYS A 2 ? ? -175.82 128.42 48 10 PHE A 11 ? ? 60.49 63.05 49 10 ARG A 114 ? ? -88.47 -75.17 50 10 PRO A 147 ? ? -60.75 89.03 51 10 VAL A 169 ? ? -64.69 95.27 52 11 CYS A 22 ? ? -160.14 111.41 53 11 CYS A 32 ? ? -157.83 88.48 54 11 SER A 110 ? ? -160.21 94.04 55 11 ARG A 121 ? ? -94.32 -60.19 56 11 PRO A 147 ? ? -56.39 94.11 57 11 VAL A 169 ? ? -67.08 90.69 58 11 ASP A 171 ? ? -58.69 107.58 59 12 TYR A 28 ? ? -123.66 -51.53 60 12 PRO A 147 ? ? -63.24 91.33 61 13 ARG A 59 ? ? -44.41 98.49 62 13 HIS A 97 ? ? 72.26 31.18 63 13 HIS A 116 ? ? 74.92 31.68 64 13 PRO A 147 ? ? -57.08 92.39 65 14 THR A 19 ? ? -141.12 27.73 66 14 CYS A 32 ? ? -157.60 83.97 67 14 PRO A 82 ? ? -88.54 -157.19 68 14 ARG A 114 ? ? -94.01 -81.49 69 14 PRO A 147 ? ? -60.82 90.20 70 15 THR A 19 ? ? -140.13 16.51 71 15 HIS A 97 ? ? 61.81 60.26 72 15 SER A 110 ? ? -167.23 99.64 73 15 ARG A 114 ? ? -96.99 -81.57 74 15 PRO A 147 ? ? -60.39 91.01 75 16 PHE A 11 ? ? 60.63 60.76 76 16 PRO A 82 ? ? -75.51 -164.50 77 16 SER A 110 ? ? -162.14 103.14 78 16 PRO A 147 ? ? -63.68 88.83 79 17 SER A 110 ? ? -164.88 109.24 80 17 PRO A 136 ? ? -56.01 170.58 81 17 PRO A 147 ? ? -58.45 91.01 82 18 LYS A 2 ? ? -176.08 132.73 83 18 SER A 74 ? ? -59.71 106.60 84 18 PRO A 147 ? ? -61.05 97.06 85 19 PRO A 82 ? ? -86.03 -152.09 86 19 LYS A 98 ? ? -106.48 -169.77 87 19 ARG A 114 ? ? -91.52 -80.63 88 19 PRO A 147 ? ? -57.52 89.02 89 20 HIS A 97 ? ? 68.91 61.37 90 20 SER A 110 ? ? -175.06 98.15 91 20 PHE A 115 ? ? -140.95 23.79 92 20 PRO A 147 ? ? -60.00 93.47 93 20 ARG A 152 ? ? -173.02 -178.72 #