data_2NBU # _entry.id 2NBU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104671 RCSB ? ? 2NBU PDB pdb_00002nbu 10.2210/pdb2nbu/pdb 25825 BMRB ? 10.13018/BMR25825 D_1000104671 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-20 2 'Structure model' 1 1 2016-08-17 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_ref_seq_dif.details' 7 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2NBU _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2016-03-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25825 BMRB unspecified . 2NBV PDB unspecified . 2NBW PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chen, X.' 1 'Walters, K.J.' 2 # _citation.id primary _citation.title ;Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome. ; _citation.journal_abbrev Structure _citation.journal_volume 24 _citation.page_first 1257 _citation.page_last 1270 _citation.year 2016 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27396824 _citation.pdbx_database_id_DOI 10.1016/j.str.2016.05.018 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, X.' 1 ? primary 'Randles, L.' 2 ? primary 'Shi, K.' 3 ? primary 'Tarasov, S.G.' 4 ? primary 'Aihara, H.' 5 ? primary 'Walters, K.J.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UV excision repair protein RAD23' _entity.formula_weight 11039.579 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 1-78' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKSTDP NSSSVDKLAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKSTDP NSSSVDKLAAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 SER n 1 4 LEU n 1 5 THR n 1 6 PHE n 1 7 LYS n 1 8 ASN n 1 9 PHE n 1 10 LYS n 1 11 LYS n 1 12 GLU n 1 13 LYS n 1 14 VAL n 1 15 PRO n 1 16 LEU n 1 17 ASP n 1 18 LEU n 1 19 GLU n 1 20 PRO n 1 21 SER n 1 22 ASN n 1 23 THR n 1 24 ILE n 1 25 LEU n 1 26 GLU n 1 27 THR n 1 28 LYS n 1 29 THR n 1 30 LYS n 1 31 LEU n 1 32 ALA n 1 33 GLN n 1 34 SER n 1 35 ILE n 1 36 SER n 1 37 CYS n 1 38 GLU n 1 39 GLU n 1 40 SER n 1 41 GLN n 1 42 ILE n 1 43 LYS n 1 44 LEU n 1 45 ILE n 1 46 TYR n 1 47 SER n 1 48 GLY n 1 49 LYS n 1 50 VAL n 1 51 LEU n 1 52 GLN n 1 53 ASP n 1 54 SER n 1 55 LYS n 1 56 THR n 1 57 VAL n 1 58 SER n 1 59 GLU n 1 60 CYS n 1 61 GLY n 1 62 LEU n 1 63 LYS n 1 64 ASP n 1 65 GLY n 1 66 ASP n 1 67 GLN n 1 68 VAL n 1 69 VAL n 1 70 PHE n 1 71 MET n 1 72 VAL n 1 73 SER n 1 74 GLN n 1 75 LYS n 1 76 LYS n 1 77 SER n 1 78 THR n 1 79 ASP n 1 80 PRO n 1 81 ASN n 1 82 SER n 1 83 SER n 1 84 SER n 1 85 VAL n 1 86 ASP n 1 87 LYS n 1 88 LEU n 1 89 ALA n 1 90 ALA n 1 91 ALA n 1 92 LEU n 1 93 GLU n 1 94 HIS n 1 95 HIS n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RAD23, YEL037C, SYGP-ORF29' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae S288c' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET23a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ASP 79 79 ? ? ? A . n A 1 80 PRO 80 80 ? ? ? A . n A 1 81 ASN 81 81 ? ? ? A . n A 1 82 SER 82 82 ? ? ? A . n A 1 83 SER 83 83 ? ? ? A . n A 1 84 SER 84 84 ? ? ? A . n A 1 85 VAL 85 85 ? ? ? A . n A 1 86 ASP 86 86 ? ? ? A . n A 1 87 LYS 87 87 ? ? ? A . n A 1 88 LEU 88 88 ? ? ? A . n A 1 89 ALA 89 89 ? ? ? A . n A 1 90 ALA 90 90 ? ? ? A . n A 1 91 ALA 91 91 ? ? ? A . n A 1 92 LEU 92 92 ? ? ? A . n A 1 93 GLU 93 93 ? ? ? A . n A 1 94 HIS 94 94 ? ? ? A . n A 1 95 HIS 95 95 ? ? ? A . n A 1 96 HIS 96 96 ? ? ? A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 HIS 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2NBU _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2NBU _struct.title 'Solution structure of the Rad23 ubiquitin-like (UBL) domain' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2NBU _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RAD23_YEAST _struct_ref.pdbx_db_accession P32628 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2NBU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P32628 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 78 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2NBU ASP A 79 ? UNP P32628 ? ? 'expression tag' 79 1 1 2NBU PRO A 80 ? UNP P32628 ? ? 'expression tag' 80 2 1 2NBU ASN A 81 ? UNP P32628 ? ? 'expression tag' 81 3 1 2NBU SER A 82 ? UNP P32628 ? ? 'expression tag' 82 4 1 2NBU SER A 83 ? UNP P32628 ? ? 'expression tag' 83 5 1 2NBU SER A 84 ? UNP P32628 ? ? 'expression tag' 84 6 1 2NBU VAL A 85 ? UNP P32628 ? ? 'expression tag' 85 7 1 2NBU ASP A 86 ? UNP P32628 ? ? 'expression tag' 86 8 1 2NBU LYS A 87 ? UNP P32628 ? ? 'expression tag' 87 9 1 2NBU LEU A 88 ? UNP P32628 ? ? 'expression tag' 88 10 1 2NBU ALA A 89 ? UNP P32628 ? ? 'expression tag' 89 11 1 2NBU ALA A 90 ? UNP P32628 ? ? 'expression tag' 90 12 1 2NBU ALA A 91 ? UNP P32628 ? ? 'expression tag' 91 13 1 2NBU LEU A 92 ? UNP P32628 ? ? 'expression tag' 92 14 1 2NBU GLU A 93 ? UNP P32628 ? ? 'expression tag' 93 15 1 2NBU HIS A 94 ? UNP P32628 ? ? 'expression tag' 94 16 1 2NBU HIS A 95 ? UNP P32628 ? ? 'expression tag' 95 17 1 2NBU HIS A 96 ? UNP P32628 ? ? 'expression tag' 96 18 1 2NBU HIS A 97 ? UNP P32628 ? ? 'expression tag' 97 19 1 2NBU HIS A 98 ? UNP P32628 ? ? 'expression tag' 98 20 1 2NBU HIS A 99 ? UNP P32628 ? ? 'expression tag' 99 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 23 ? SER A 36 ? THR A 23 SER A 36 1 ? 14 HELX_P HELX_P2 2 THR A 56 ? GLY A 61 ? THR A 56 GLY A 61 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 13 ? LEU A 18 ? LYS A 13 LEU A 18 A 2 VAL A 2 ? LYS A 7 ? VAL A 2 LYS A 7 A 3 VAL A 68 ? VAL A 72 ? VAL A 68 VAL A 72 A 4 ILE A 42 ? ILE A 45 ? ILE A 42 ILE A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 16 ? O LEU A 16 N LEU A 4 ? N LEU A 4 A 2 3 N THR A 5 ? N THR A 5 O VAL A 68 ? O VAL A 68 A 3 4 O VAL A 69 ? O VAL A 69 N ILE A 45 ? N ILE A 45 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 8 ? ? -115.60 -165.84 2 1 SER A 36 ? ? 85.02 22.83 3 1 VAL A 50 ? ? -67.57 89.34 4 1 LEU A 51 ? ? -51.21 171.55 5 1 LYS A 63 ? ? -126.09 -162.14 6 1 ASP A 66 ? ? -69.15 -168.67 7 1 GLN A 74 ? ? -46.86 158.66 8 2 ASN A 8 ? ? -109.00 -168.41 9 2 LYS A 11 ? ? 58.52 19.56 10 2 ILE A 24 ? ? -36.61 -39.22 11 2 SER A 36 ? ? 82.44 26.50 12 2 VAL A 50 ? ? -66.00 98.72 13 2 LEU A 51 ? ? -50.29 170.50 14 2 LYS A 63 ? ? -129.38 -163.68 15 2 ASP A 66 ? ? -62.36 -170.93 16 2 GLN A 74 ? ? 38.38 -97.37 17 2 LYS A 76 ? ? -84.53 -138.49 18 3 ASN A 8 ? ? -111.48 -167.00 19 3 SER A 36 ? ? 81.46 32.07 20 3 VAL A 50 ? ? -67.63 95.76 21 3 LEU A 51 ? ? -50.17 171.96 22 3 LYS A 63 ? ? -123.08 -160.28 23 3 ASP A 66 ? ? -63.06 -173.35 24 3 LYS A 75 ? ? 31.61 -124.48 25 3 SER A 77 ? ? -168.76 107.82 26 4 PHE A 9 ? ? -65.35 9.81 27 4 SER A 36 ? ? 83.96 28.26 28 4 VAL A 50 ? ? -69.07 91.43 29 4 LEU A 51 ? ? -50.44 170.76 30 4 LYS A 63 ? ? -125.97 -162.77 31 4 ASP A 66 ? ? -63.94 -172.11 32 4 GLN A 74 ? ? 70.36 -64.04 33 4 LYS A 75 ? ? -65.96 6.16 34 4 LYS A 76 ? ? -55.39 95.22 35 5 ASN A 8 ? ? -115.28 -168.20 36 5 ILE A 24 ? ? -39.74 -37.50 37 5 SER A 36 ? ? 86.35 24.95 38 5 VAL A 50 ? ? -67.73 95.33 39 5 LEU A 51 ? ? -50.35 170.50 40 5 LYS A 63 ? ? -128.72 -163.46 41 5 ASP A 66 ? ? -60.40 -173.04 42 6 SER A 36 ? ? 85.84 23.32 43 6 VAL A 50 ? ? -66.45 94.46 44 6 LEU A 51 ? ? -52.31 170.88 45 7 ASN A 8 ? ? -115.13 -164.17 46 7 LYS A 11 ? ? 59.36 13.29 47 7 ILE A 24 ? ? -38.60 -38.95 48 7 SER A 36 ? ? 80.41 32.43 49 7 VAL A 50 ? ? -66.70 97.85 50 7 LEU A 51 ? ? -50.28 170.51 51 7 LYS A 63 ? ? -125.91 -159.90 52 7 ASP A 66 ? ? -63.80 -172.61 53 8 ASN A 8 ? ? -110.33 -164.03 54 8 LYS A 11 ? ? 59.11 18.45 55 8 SER A 36 ? ? 85.85 22.39 56 8 VAL A 50 ? ? -68.38 88.47 57 8 LEU A 51 ? ? -50.45 171.18 58 8 LYS A 63 ? ? -121.60 -159.78 59 8 ASP A 66 ? ? -63.83 -173.69 60 8 LYS A 75 ? ? -57.72 -158.72 61 8 SER A 77 ? ? -50.25 -177.72 62 9 ASN A 8 ? ? -108.51 -168.97 63 9 ILE A 24 ? ? -35.11 -38.49 64 9 SER A 36 ? ? 85.66 22.98 65 9 VAL A 50 ? ? -65.37 98.67 66 9 LEU A 51 ? ? -50.40 170.56 67 9 LYS A 63 ? ? -128.86 -164.42 68 9 ASP A 66 ? ? -65.40 -166.72 69 9 SER A 77 ? ? -172.03 83.06 70 10 ILE A 24 ? ? -36.38 -39.92 71 10 SER A 36 ? ? 83.32 30.02 72 10 VAL A 50 ? ? -67.18 96.69 73 10 LEU A 51 ? ? -49.85 170.48 74 10 LYS A 63 ? ? -127.59 -161.69 75 10 ASP A 66 ? ? -68.33 -173.93 76 10 GLN A 74 ? ? -55.87 -103.15 77 10 LYS A 75 ? ? 17.84 75.71 78 10 SER A 77 ? ? 55.60 -105.05 79 11 ASN A 8 ? ? -110.08 -164.30 80 11 SER A 36 ? ? 87.21 23.65 81 11 VAL A 50 ? ? -68.70 99.41 82 11 LEU A 51 ? ? -50.28 170.88 83 11 LYS A 63 ? ? -124.53 -162.33 84 11 ASP A 66 ? ? -62.93 -177.98 85 11 SER A 77 ? ? 42.01 -156.47 86 12 ASN A 8 ? ? -119.07 -166.65 87 12 ILE A 24 ? ? -36.96 -39.56 88 12 SER A 36 ? ? 86.57 24.33 89 12 LEU A 51 ? ? -50.31 170.79 90 12 LYS A 63 ? ? -127.58 -160.36 91 12 ASP A 66 ? ? -66.62 -165.26 92 12 SER A 77 ? ? -161.26 84.81 93 13 ASN A 8 ? ? -117.58 -165.18 94 13 SER A 36 ? ? 84.61 23.11 95 13 VAL A 50 ? ? -68.58 94.84 96 13 LEU A 51 ? ? -50.51 170.74 97 13 LYS A 63 ? ? -124.36 -163.02 98 13 ASP A 66 ? ? -64.88 -174.93 99 13 SER A 77 ? ? 44.93 83.05 100 14 ASN A 8 ? ? -113.58 -168.35 101 14 SER A 36 ? ? 85.07 24.72 102 14 VAL A 50 ? ? -68.98 97.89 103 14 LEU A 51 ? ? -56.97 171.60 104 14 LYS A 63 ? ? -129.09 -160.71 105 14 ASP A 66 ? ? -69.49 -169.38 106 14 LYS A 76 ? ? -89.28 -136.08 107 14 SER A 77 ? ? -171.96 111.12 108 15 ASN A 8 ? ? -118.59 -164.43 109 15 ILE A 24 ? ? -35.78 -39.22 110 15 SER A 36 ? ? 85.43 22.76 111 15 LEU A 51 ? ? -50.33 170.67 112 15 LYS A 63 ? ? -129.60 -164.18 113 15 ASP A 66 ? ? -62.54 -172.85 114 15 LYS A 76 ? ? -60.87 -115.72 115 15 SER A 77 ? ? -171.22 -37.44 116 16 ASN A 8 ? ? -115.45 -167.45 117 16 SER A 36 ? ? 83.60 29.15 118 16 LEU A 51 ? ? -54.29 170.91 119 16 LYS A 63 ? ? -122.25 -159.08 120 16 ASP A 66 ? ? -62.48 -168.95 121 17 ASN A 8 ? ? -113.68 -167.07 122 17 SER A 36 ? ? 89.07 25.57 123 17 VAL A 50 ? ? -65.49 93.08 124 17 LEU A 51 ? ? -50.57 170.86 125 17 LYS A 63 ? ? -126.91 -159.56 126 17 ASP A 66 ? ? -63.09 -170.95 127 17 LYS A 75 ? ? -60.83 -79.80 128 17 SER A 77 ? ? -68.42 -159.81 129 18 ASN A 8 ? ? -108.77 -167.41 130 18 ILE A 24 ? ? -38.82 -39.80 131 18 SER A 36 ? ? 83.55 27.78 132 18 VAL A 50 ? ? -67.25 91.45 133 18 LEU A 51 ? ? -50.31 170.84 134 18 LYS A 63 ? ? -125.60 -160.41 135 18 ASP A 66 ? ? -66.77 -163.94 136 18 GLN A 74 ? ? 65.26 -66.58 137 19 ASN A 8 ? ? -96.90 -159.61 138 19 LYS A 11 ? ? 83.27 51.68 139 19 ILE A 24 ? ? -37.08 -39.12 140 19 SER A 36 ? ? 84.22 23.71 141 19 LEU A 51 ? ? -50.31 171.02 142 19 LYS A 63 ? ? -121.04 -158.72 143 19 ASP A 66 ? ? -61.61 -166.94 144 19 LYS A 75 ? ? -108.50 67.55 145 19 LYS A 76 ? ? -141.19 26.98 146 19 SER A 77 ? ? 48.59 82.37 147 20 ASN A 8 ? ? -119.32 -158.57 148 20 ILE A 24 ? ? -34.93 -39.63 149 20 SER A 36 ? ? 83.99 23.37 150 20 VAL A 50 ? ? -69.60 92.12 151 20 LEU A 51 ? ? -50.57 170.65 152 20 LYS A 63 ? ? -126.97 -163.49 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2NBU _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2NBU _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.7 mM [U-100% 13C; U-100% 15N] shuttling protein, 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM DTT, 0.1 % sodium azide, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;0.7 mM [U-100% 13C; U-100% 15N] shuttling protein, 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM DTT, 0.1 % sodium azide, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'shuttling protein-1' 0.7 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 DTT-4 2 ? mM ? 1 'sodium azide-5' 0.1 ? % ? 1 'shuttling protein-6' 0.7 ? mM '[U-100% 13C; U-100% 15N]' 2 'sodium phosphate-7' 20 ? mM ? 2 'sodium chloride-8' 50 ? mM ? 2 DTT-9 2 ? mM ? 2 'sodium azide-10' 0.1 ? % ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACO' 1 5 1 '3D HNCO' 1 6 1 '3D 1H-15N NOESY' 1 7 2 '2D 1H-13C HSQC aliphatic' 1 8 2 '3D HCCH-TCOSY' 1 9 2 '2D 1H-13C HSQC aliphatic' 1 10 2 '3D 1H-13C NOESY aliphatic' # _pdbx_nmr_refine.entry_id 2NBU _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Bartels et al.' 'chemical shift assignment' XEASY ? 3 'Bartels et al.' 'peak picking' XEASY ? 4 'Bartels et al.' 'data analysis' XEASY ? 5 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 6 'Cornilescu, Delaglio and Bax' 'structure solution' TALOS ? 7 'Cornilescu, Delaglio and Bax' refinement TALOS ? 8 'Schwieters, Kuszewski, Tjandra and Clore' 'data analysis' 'X-PLOR NIH' ? 9 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 10 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 11 'Laskowski and MacArthur' refinement ProcheckNMR ? 12 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 79 ? A ASP 79 2 1 Y 1 A PRO 80 ? A PRO 80 3 1 Y 1 A ASN 81 ? A ASN 81 4 1 Y 1 A SER 82 ? A SER 82 5 1 Y 1 A SER 83 ? A SER 83 6 1 Y 1 A SER 84 ? A SER 84 7 1 Y 1 A VAL 85 ? A VAL 85 8 1 Y 1 A ASP 86 ? A ASP 86 9 1 Y 1 A LYS 87 ? A LYS 87 10 1 Y 1 A LEU 88 ? A LEU 88 11 1 Y 1 A ALA 89 ? A ALA 89 12 1 Y 1 A ALA 90 ? A ALA 90 13 1 Y 1 A ALA 91 ? A ALA 91 14 1 Y 1 A LEU 92 ? A LEU 92 15 1 Y 1 A GLU 93 ? A GLU 93 16 1 Y 1 A HIS 94 ? A HIS 94 17 1 Y 1 A HIS 95 ? A HIS 95 18 1 Y 1 A HIS 96 ? A HIS 96 19 1 Y 1 A HIS 97 ? A HIS 97 20 1 Y 1 A HIS 98 ? A HIS 98 21 1 Y 1 A HIS 99 ? A HIS 99 22 2 Y 1 A ASP 79 ? A ASP 79 23 2 Y 1 A PRO 80 ? A PRO 80 24 2 Y 1 A ASN 81 ? A ASN 81 25 2 Y 1 A SER 82 ? A SER 82 26 2 Y 1 A SER 83 ? A SER 83 27 2 Y 1 A SER 84 ? A SER 84 28 2 Y 1 A VAL 85 ? A VAL 85 29 2 Y 1 A ASP 86 ? A ASP 86 30 2 Y 1 A LYS 87 ? A LYS 87 31 2 Y 1 A LEU 88 ? A LEU 88 32 2 Y 1 A ALA 89 ? A ALA 89 33 2 Y 1 A ALA 90 ? A ALA 90 34 2 Y 1 A ALA 91 ? A ALA 91 35 2 Y 1 A LEU 92 ? A LEU 92 36 2 Y 1 A GLU 93 ? A GLU 93 37 2 Y 1 A HIS 94 ? A HIS 94 38 2 Y 1 A HIS 95 ? A HIS 95 39 2 Y 1 A HIS 96 ? A HIS 96 40 2 Y 1 A HIS 97 ? A HIS 97 41 2 Y 1 A HIS 98 ? A HIS 98 42 2 Y 1 A HIS 99 ? A HIS 99 43 3 Y 1 A ASP 79 ? A ASP 79 44 3 Y 1 A PRO 80 ? A PRO 80 45 3 Y 1 A ASN 81 ? A ASN 81 46 3 Y 1 A SER 82 ? A SER 82 47 3 Y 1 A SER 83 ? A SER 83 48 3 Y 1 A SER 84 ? A SER 84 49 3 Y 1 A VAL 85 ? A VAL 85 50 3 Y 1 A ASP 86 ? A ASP 86 51 3 Y 1 A LYS 87 ? A LYS 87 52 3 Y 1 A LEU 88 ? A LEU 88 53 3 Y 1 A ALA 89 ? A ALA 89 54 3 Y 1 A ALA 90 ? A ALA 90 55 3 Y 1 A ALA 91 ? A ALA 91 56 3 Y 1 A LEU 92 ? A LEU 92 57 3 Y 1 A GLU 93 ? A GLU 93 58 3 Y 1 A HIS 94 ? A HIS 94 59 3 Y 1 A HIS 95 ? A HIS 95 60 3 Y 1 A HIS 96 ? A HIS 96 61 3 Y 1 A HIS 97 ? A HIS 97 62 3 Y 1 A HIS 98 ? A HIS 98 63 3 Y 1 A HIS 99 ? A HIS 99 64 4 Y 1 A ASP 79 ? A ASP 79 65 4 Y 1 A PRO 80 ? A PRO 80 66 4 Y 1 A ASN 81 ? A ASN 81 67 4 Y 1 A SER 82 ? A SER 82 68 4 Y 1 A SER 83 ? A SER 83 69 4 Y 1 A SER 84 ? A SER 84 70 4 Y 1 A VAL 85 ? A VAL 85 71 4 Y 1 A ASP 86 ? A ASP 86 72 4 Y 1 A LYS 87 ? A LYS 87 73 4 Y 1 A LEU 88 ? A LEU 88 74 4 Y 1 A ALA 89 ? A ALA 89 75 4 Y 1 A ALA 90 ? A ALA 90 76 4 Y 1 A ALA 91 ? A ALA 91 77 4 Y 1 A LEU 92 ? A LEU 92 78 4 Y 1 A GLU 93 ? A GLU 93 79 4 Y 1 A HIS 94 ? A HIS 94 80 4 Y 1 A HIS 95 ? A HIS 95 81 4 Y 1 A HIS 96 ? A HIS 96 82 4 Y 1 A HIS 97 ? A HIS 97 83 4 Y 1 A HIS 98 ? A HIS 98 84 4 Y 1 A HIS 99 ? A HIS 99 85 5 Y 1 A ASP 79 ? A ASP 79 86 5 Y 1 A PRO 80 ? A PRO 80 87 5 Y 1 A ASN 81 ? A ASN 81 88 5 Y 1 A SER 82 ? A SER 82 89 5 Y 1 A SER 83 ? A SER 83 90 5 Y 1 A SER 84 ? A SER 84 91 5 Y 1 A VAL 85 ? A VAL 85 92 5 Y 1 A ASP 86 ? A ASP 86 93 5 Y 1 A LYS 87 ? A LYS 87 94 5 Y 1 A LEU 88 ? A LEU 88 95 5 Y 1 A ALA 89 ? A ALA 89 96 5 Y 1 A ALA 90 ? A ALA 90 97 5 Y 1 A ALA 91 ? A ALA 91 98 5 Y 1 A LEU 92 ? A LEU 92 99 5 Y 1 A GLU 93 ? A GLU 93 100 5 Y 1 A HIS 94 ? A HIS 94 101 5 Y 1 A HIS 95 ? A HIS 95 102 5 Y 1 A HIS 96 ? A HIS 96 103 5 Y 1 A HIS 97 ? A HIS 97 104 5 Y 1 A HIS 98 ? A HIS 98 105 5 Y 1 A HIS 99 ? A HIS 99 106 6 Y 1 A ASP 79 ? A ASP 79 107 6 Y 1 A PRO 80 ? A PRO 80 108 6 Y 1 A ASN 81 ? A ASN 81 109 6 Y 1 A SER 82 ? A SER 82 110 6 Y 1 A SER 83 ? A SER 83 111 6 Y 1 A SER 84 ? A SER 84 112 6 Y 1 A VAL 85 ? A VAL 85 113 6 Y 1 A ASP 86 ? A ASP 86 114 6 Y 1 A LYS 87 ? A LYS 87 115 6 Y 1 A LEU 88 ? A LEU 88 116 6 Y 1 A ALA 89 ? A ALA 89 117 6 Y 1 A ALA 90 ? A ALA 90 118 6 Y 1 A ALA 91 ? A ALA 91 119 6 Y 1 A LEU 92 ? A LEU 92 120 6 Y 1 A GLU 93 ? A GLU 93 121 6 Y 1 A HIS 94 ? A HIS 94 122 6 Y 1 A HIS 95 ? A HIS 95 123 6 Y 1 A HIS 96 ? A HIS 96 124 6 Y 1 A HIS 97 ? A HIS 97 125 6 Y 1 A HIS 98 ? A HIS 98 126 6 Y 1 A HIS 99 ? A HIS 99 127 7 Y 1 A ASP 79 ? A ASP 79 128 7 Y 1 A PRO 80 ? A PRO 80 129 7 Y 1 A ASN 81 ? A ASN 81 130 7 Y 1 A SER 82 ? A SER 82 131 7 Y 1 A SER 83 ? A SER 83 132 7 Y 1 A SER 84 ? A SER 84 133 7 Y 1 A VAL 85 ? A VAL 85 134 7 Y 1 A ASP 86 ? A ASP 86 135 7 Y 1 A LYS 87 ? A LYS 87 136 7 Y 1 A LEU 88 ? A LEU 88 137 7 Y 1 A ALA 89 ? A ALA 89 138 7 Y 1 A ALA 90 ? A ALA 90 139 7 Y 1 A ALA 91 ? A ALA 91 140 7 Y 1 A LEU 92 ? A LEU 92 141 7 Y 1 A GLU 93 ? A GLU 93 142 7 Y 1 A HIS 94 ? A HIS 94 143 7 Y 1 A HIS 95 ? A HIS 95 144 7 Y 1 A HIS 96 ? A HIS 96 145 7 Y 1 A HIS 97 ? A HIS 97 146 7 Y 1 A HIS 98 ? A HIS 98 147 7 Y 1 A HIS 99 ? A HIS 99 148 8 Y 1 A ASP 79 ? A ASP 79 149 8 Y 1 A PRO 80 ? A PRO 80 150 8 Y 1 A ASN 81 ? A ASN 81 151 8 Y 1 A SER 82 ? A SER 82 152 8 Y 1 A SER 83 ? A SER 83 153 8 Y 1 A SER 84 ? A SER 84 154 8 Y 1 A VAL 85 ? A VAL 85 155 8 Y 1 A ASP 86 ? A ASP 86 156 8 Y 1 A LYS 87 ? A LYS 87 157 8 Y 1 A LEU 88 ? A LEU 88 158 8 Y 1 A ALA 89 ? A ALA 89 159 8 Y 1 A ALA 90 ? A ALA 90 160 8 Y 1 A ALA 91 ? A ALA 91 161 8 Y 1 A LEU 92 ? A LEU 92 162 8 Y 1 A GLU 93 ? A GLU 93 163 8 Y 1 A HIS 94 ? A HIS 94 164 8 Y 1 A HIS 95 ? A HIS 95 165 8 Y 1 A HIS 96 ? A HIS 96 166 8 Y 1 A HIS 97 ? A HIS 97 167 8 Y 1 A HIS 98 ? A HIS 98 168 8 Y 1 A HIS 99 ? A HIS 99 169 9 Y 1 A ASP 79 ? A ASP 79 170 9 Y 1 A PRO 80 ? A PRO 80 171 9 Y 1 A ASN 81 ? A ASN 81 172 9 Y 1 A SER 82 ? A SER 82 173 9 Y 1 A SER 83 ? A SER 83 174 9 Y 1 A SER 84 ? A SER 84 175 9 Y 1 A VAL 85 ? A VAL 85 176 9 Y 1 A ASP 86 ? A ASP 86 177 9 Y 1 A LYS 87 ? A LYS 87 178 9 Y 1 A LEU 88 ? A LEU 88 179 9 Y 1 A ALA 89 ? A ALA 89 180 9 Y 1 A ALA 90 ? A ALA 90 181 9 Y 1 A ALA 91 ? A ALA 91 182 9 Y 1 A LEU 92 ? A LEU 92 183 9 Y 1 A GLU 93 ? A GLU 93 184 9 Y 1 A HIS 94 ? A HIS 94 185 9 Y 1 A HIS 95 ? A HIS 95 186 9 Y 1 A HIS 96 ? A HIS 96 187 9 Y 1 A HIS 97 ? A HIS 97 188 9 Y 1 A HIS 98 ? A HIS 98 189 9 Y 1 A HIS 99 ? A HIS 99 190 10 Y 1 A ASP 79 ? A ASP 79 191 10 Y 1 A PRO 80 ? A PRO 80 192 10 Y 1 A ASN 81 ? A ASN 81 193 10 Y 1 A SER 82 ? A SER 82 194 10 Y 1 A SER 83 ? A SER 83 195 10 Y 1 A SER 84 ? A SER 84 196 10 Y 1 A VAL 85 ? A VAL 85 197 10 Y 1 A ASP 86 ? A ASP 86 198 10 Y 1 A LYS 87 ? A LYS 87 199 10 Y 1 A LEU 88 ? A LEU 88 200 10 Y 1 A ALA 89 ? A ALA 89 201 10 Y 1 A ALA 90 ? A ALA 90 202 10 Y 1 A ALA 91 ? A ALA 91 203 10 Y 1 A LEU 92 ? A LEU 92 204 10 Y 1 A GLU 93 ? A GLU 93 205 10 Y 1 A HIS 94 ? A HIS 94 206 10 Y 1 A HIS 95 ? A HIS 95 207 10 Y 1 A HIS 96 ? A HIS 96 208 10 Y 1 A HIS 97 ? A HIS 97 209 10 Y 1 A HIS 98 ? A HIS 98 210 10 Y 1 A HIS 99 ? A HIS 99 211 11 Y 1 A ASP 79 ? A ASP 79 212 11 Y 1 A PRO 80 ? A PRO 80 213 11 Y 1 A ASN 81 ? A ASN 81 214 11 Y 1 A SER 82 ? A SER 82 215 11 Y 1 A SER 83 ? A SER 83 216 11 Y 1 A SER 84 ? A SER 84 217 11 Y 1 A VAL 85 ? A VAL 85 218 11 Y 1 A ASP 86 ? A ASP 86 219 11 Y 1 A LYS 87 ? A LYS 87 220 11 Y 1 A LEU 88 ? A LEU 88 221 11 Y 1 A ALA 89 ? A ALA 89 222 11 Y 1 A ALA 90 ? A ALA 90 223 11 Y 1 A ALA 91 ? A ALA 91 224 11 Y 1 A LEU 92 ? A LEU 92 225 11 Y 1 A GLU 93 ? A GLU 93 226 11 Y 1 A HIS 94 ? A HIS 94 227 11 Y 1 A HIS 95 ? A HIS 95 228 11 Y 1 A HIS 96 ? A HIS 96 229 11 Y 1 A HIS 97 ? A HIS 97 230 11 Y 1 A HIS 98 ? A HIS 98 231 11 Y 1 A HIS 99 ? A HIS 99 232 12 Y 1 A ASP 79 ? A ASP 79 233 12 Y 1 A PRO 80 ? A PRO 80 234 12 Y 1 A ASN 81 ? A ASN 81 235 12 Y 1 A SER 82 ? A SER 82 236 12 Y 1 A SER 83 ? A SER 83 237 12 Y 1 A SER 84 ? A SER 84 238 12 Y 1 A VAL 85 ? A VAL 85 239 12 Y 1 A ASP 86 ? A ASP 86 240 12 Y 1 A LYS 87 ? A LYS 87 241 12 Y 1 A LEU 88 ? A LEU 88 242 12 Y 1 A ALA 89 ? A ALA 89 243 12 Y 1 A ALA 90 ? A ALA 90 244 12 Y 1 A ALA 91 ? A ALA 91 245 12 Y 1 A LEU 92 ? A LEU 92 246 12 Y 1 A GLU 93 ? A GLU 93 247 12 Y 1 A HIS 94 ? A HIS 94 248 12 Y 1 A HIS 95 ? A HIS 95 249 12 Y 1 A HIS 96 ? A HIS 96 250 12 Y 1 A HIS 97 ? A HIS 97 251 12 Y 1 A HIS 98 ? A HIS 98 252 12 Y 1 A HIS 99 ? A HIS 99 253 13 Y 1 A ASP 79 ? A ASP 79 254 13 Y 1 A PRO 80 ? A PRO 80 255 13 Y 1 A ASN 81 ? A ASN 81 256 13 Y 1 A SER 82 ? A SER 82 257 13 Y 1 A SER 83 ? A SER 83 258 13 Y 1 A SER 84 ? A SER 84 259 13 Y 1 A VAL 85 ? A VAL 85 260 13 Y 1 A ASP 86 ? A ASP 86 261 13 Y 1 A LYS 87 ? A LYS 87 262 13 Y 1 A LEU 88 ? A LEU 88 263 13 Y 1 A ALA 89 ? A ALA 89 264 13 Y 1 A ALA 90 ? A ALA 90 265 13 Y 1 A ALA 91 ? A ALA 91 266 13 Y 1 A LEU 92 ? A LEU 92 267 13 Y 1 A GLU 93 ? A GLU 93 268 13 Y 1 A HIS 94 ? A HIS 94 269 13 Y 1 A HIS 95 ? A HIS 95 270 13 Y 1 A HIS 96 ? A HIS 96 271 13 Y 1 A HIS 97 ? A HIS 97 272 13 Y 1 A HIS 98 ? A HIS 98 273 13 Y 1 A HIS 99 ? A HIS 99 274 14 Y 1 A ASP 79 ? A ASP 79 275 14 Y 1 A PRO 80 ? A PRO 80 276 14 Y 1 A ASN 81 ? A ASN 81 277 14 Y 1 A SER 82 ? A SER 82 278 14 Y 1 A SER 83 ? A SER 83 279 14 Y 1 A SER 84 ? A SER 84 280 14 Y 1 A VAL 85 ? A VAL 85 281 14 Y 1 A ASP 86 ? A ASP 86 282 14 Y 1 A LYS 87 ? A LYS 87 283 14 Y 1 A LEU 88 ? A LEU 88 284 14 Y 1 A ALA 89 ? A ALA 89 285 14 Y 1 A ALA 90 ? A ALA 90 286 14 Y 1 A ALA 91 ? A ALA 91 287 14 Y 1 A LEU 92 ? A LEU 92 288 14 Y 1 A GLU 93 ? A GLU 93 289 14 Y 1 A HIS 94 ? A HIS 94 290 14 Y 1 A HIS 95 ? A HIS 95 291 14 Y 1 A HIS 96 ? A HIS 96 292 14 Y 1 A HIS 97 ? A HIS 97 293 14 Y 1 A HIS 98 ? A HIS 98 294 14 Y 1 A HIS 99 ? A HIS 99 295 15 Y 1 A ASP 79 ? A ASP 79 296 15 Y 1 A PRO 80 ? A PRO 80 297 15 Y 1 A ASN 81 ? A ASN 81 298 15 Y 1 A SER 82 ? A SER 82 299 15 Y 1 A SER 83 ? A SER 83 300 15 Y 1 A SER 84 ? A SER 84 301 15 Y 1 A VAL 85 ? A VAL 85 302 15 Y 1 A ASP 86 ? A ASP 86 303 15 Y 1 A LYS 87 ? A LYS 87 304 15 Y 1 A LEU 88 ? A LEU 88 305 15 Y 1 A ALA 89 ? A ALA 89 306 15 Y 1 A ALA 90 ? A ALA 90 307 15 Y 1 A ALA 91 ? A ALA 91 308 15 Y 1 A LEU 92 ? A LEU 92 309 15 Y 1 A GLU 93 ? A GLU 93 310 15 Y 1 A HIS 94 ? A HIS 94 311 15 Y 1 A HIS 95 ? A HIS 95 312 15 Y 1 A HIS 96 ? A HIS 96 313 15 Y 1 A HIS 97 ? A HIS 97 314 15 Y 1 A HIS 98 ? A HIS 98 315 15 Y 1 A HIS 99 ? A HIS 99 316 16 Y 1 A ASP 79 ? A ASP 79 317 16 Y 1 A PRO 80 ? A PRO 80 318 16 Y 1 A ASN 81 ? A ASN 81 319 16 Y 1 A SER 82 ? A SER 82 320 16 Y 1 A SER 83 ? A SER 83 321 16 Y 1 A SER 84 ? A SER 84 322 16 Y 1 A VAL 85 ? A VAL 85 323 16 Y 1 A ASP 86 ? A ASP 86 324 16 Y 1 A LYS 87 ? A LYS 87 325 16 Y 1 A LEU 88 ? A LEU 88 326 16 Y 1 A ALA 89 ? A ALA 89 327 16 Y 1 A ALA 90 ? A ALA 90 328 16 Y 1 A ALA 91 ? A ALA 91 329 16 Y 1 A LEU 92 ? A LEU 92 330 16 Y 1 A GLU 93 ? A GLU 93 331 16 Y 1 A HIS 94 ? A HIS 94 332 16 Y 1 A HIS 95 ? A HIS 95 333 16 Y 1 A HIS 96 ? A HIS 96 334 16 Y 1 A HIS 97 ? A HIS 97 335 16 Y 1 A HIS 98 ? A HIS 98 336 16 Y 1 A HIS 99 ? A HIS 99 337 17 Y 1 A ASP 79 ? A ASP 79 338 17 Y 1 A PRO 80 ? A PRO 80 339 17 Y 1 A ASN 81 ? A ASN 81 340 17 Y 1 A SER 82 ? A SER 82 341 17 Y 1 A SER 83 ? A SER 83 342 17 Y 1 A SER 84 ? A SER 84 343 17 Y 1 A VAL 85 ? A VAL 85 344 17 Y 1 A ASP 86 ? A ASP 86 345 17 Y 1 A LYS 87 ? A LYS 87 346 17 Y 1 A LEU 88 ? A LEU 88 347 17 Y 1 A ALA 89 ? A ALA 89 348 17 Y 1 A ALA 90 ? A ALA 90 349 17 Y 1 A ALA 91 ? A ALA 91 350 17 Y 1 A LEU 92 ? A LEU 92 351 17 Y 1 A GLU 93 ? A GLU 93 352 17 Y 1 A HIS 94 ? A HIS 94 353 17 Y 1 A HIS 95 ? A HIS 95 354 17 Y 1 A HIS 96 ? A HIS 96 355 17 Y 1 A HIS 97 ? A HIS 97 356 17 Y 1 A HIS 98 ? A HIS 98 357 17 Y 1 A HIS 99 ? A HIS 99 358 18 Y 1 A ASP 79 ? A ASP 79 359 18 Y 1 A PRO 80 ? A PRO 80 360 18 Y 1 A ASN 81 ? A ASN 81 361 18 Y 1 A SER 82 ? A SER 82 362 18 Y 1 A SER 83 ? A SER 83 363 18 Y 1 A SER 84 ? A SER 84 364 18 Y 1 A VAL 85 ? A VAL 85 365 18 Y 1 A ASP 86 ? A ASP 86 366 18 Y 1 A LYS 87 ? A LYS 87 367 18 Y 1 A LEU 88 ? A LEU 88 368 18 Y 1 A ALA 89 ? A ALA 89 369 18 Y 1 A ALA 90 ? A ALA 90 370 18 Y 1 A ALA 91 ? A ALA 91 371 18 Y 1 A LEU 92 ? A LEU 92 372 18 Y 1 A GLU 93 ? A GLU 93 373 18 Y 1 A HIS 94 ? A HIS 94 374 18 Y 1 A HIS 95 ? A HIS 95 375 18 Y 1 A HIS 96 ? A HIS 96 376 18 Y 1 A HIS 97 ? A HIS 97 377 18 Y 1 A HIS 98 ? A HIS 98 378 18 Y 1 A HIS 99 ? A HIS 99 379 19 Y 1 A ASP 79 ? A ASP 79 380 19 Y 1 A PRO 80 ? A PRO 80 381 19 Y 1 A ASN 81 ? A ASN 81 382 19 Y 1 A SER 82 ? A SER 82 383 19 Y 1 A SER 83 ? A SER 83 384 19 Y 1 A SER 84 ? A SER 84 385 19 Y 1 A VAL 85 ? A VAL 85 386 19 Y 1 A ASP 86 ? A ASP 86 387 19 Y 1 A LYS 87 ? A LYS 87 388 19 Y 1 A LEU 88 ? A LEU 88 389 19 Y 1 A ALA 89 ? A ALA 89 390 19 Y 1 A ALA 90 ? A ALA 90 391 19 Y 1 A ALA 91 ? A ALA 91 392 19 Y 1 A LEU 92 ? A LEU 92 393 19 Y 1 A GLU 93 ? A GLU 93 394 19 Y 1 A HIS 94 ? A HIS 94 395 19 Y 1 A HIS 95 ? A HIS 95 396 19 Y 1 A HIS 96 ? A HIS 96 397 19 Y 1 A HIS 97 ? A HIS 97 398 19 Y 1 A HIS 98 ? A HIS 98 399 19 Y 1 A HIS 99 ? A HIS 99 400 20 Y 1 A ASP 79 ? A ASP 79 401 20 Y 1 A PRO 80 ? A PRO 80 402 20 Y 1 A ASN 81 ? A ASN 81 403 20 Y 1 A SER 82 ? A SER 82 404 20 Y 1 A SER 83 ? A SER 83 405 20 Y 1 A SER 84 ? A SER 84 406 20 Y 1 A VAL 85 ? A VAL 85 407 20 Y 1 A ASP 86 ? A ASP 86 408 20 Y 1 A LYS 87 ? A LYS 87 409 20 Y 1 A LEU 88 ? A LEU 88 410 20 Y 1 A ALA 89 ? A ALA 89 411 20 Y 1 A ALA 90 ? A ALA 90 412 20 Y 1 A ALA 91 ? A ALA 91 413 20 Y 1 A LEU 92 ? A LEU 92 414 20 Y 1 A GLU 93 ? A GLU 93 415 20 Y 1 A HIS 94 ? A HIS 94 416 20 Y 1 A HIS 95 ? A HIS 95 417 20 Y 1 A HIS 96 ? A HIS 96 418 20 Y 1 A HIS 97 ? A HIS 97 419 20 Y 1 A HIS 98 ? A HIS 98 420 20 Y 1 A HIS 99 ? A HIS 99 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PHE N N N N 220 PHE CA C N S 221 PHE C C N N 222 PHE O O N N 223 PHE CB C N N 224 PHE CG C Y N 225 PHE CD1 C Y N 226 PHE CD2 C Y N 227 PHE CE1 C Y N 228 PHE CE2 C Y N 229 PHE CZ C Y N 230 PHE OXT O N N 231 PHE H H N N 232 PHE H2 H N N 233 PHE HA H N N 234 PHE HB2 H N N 235 PHE HB3 H N N 236 PHE HD1 H N N 237 PHE HD2 H N N 238 PHE HE1 H N N 239 PHE HE2 H N N 240 PHE HZ H N N 241 PHE HXT H N N 242 PRO N N N N 243 PRO CA C N S 244 PRO C C N N 245 PRO O O N N 246 PRO CB C N N 247 PRO CG C N N 248 PRO CD C N N 249 PRO OXT O N N 250 PRO H H N N 251 PRO HA H N N 252 PRO HB2 H N N 253 PRO HB3 H N N 254 PRO HG2 H N N 255 PRO HG3 H N N 256 PRO HD2 H N N 257 PRO HD3 H N N 258 PRO HXT H N N 259 SER N N N N 260 SER CA C N S 261 SER C C N N 262 SER O O N N 263 SER CB C N N 264 SER OG O N N 265 SER OXT O N N 266 SER H H N N 267 SER H2 H N N 268 SER HA H N N 269 SER HB2 H N N 270 SER HB3 H N N 271 SER HG H N N 272 SER HXT H N N 273 THR N N N N 274 THR CA C N S 275 THR C C N N 276 THR O O N N 277 THR CB C N R 278 THR OG1 O N N 279 THR CG2 C N N 280 THR OXT O N N 281 THR H H N N 282 THR H2 H N N 283 THR HA H N N 284 THR HB H N N 285 THR HG1 H N N 286 THR HG21 H N N 287 THR HG22 H N N 288 THR HG23 H N N 289 THR HXT H N N 290 TYR N N N N 291 TYR CA C N S 292 TYR C C N N 293 TYR O O N N 294 TYR CB C N N 295 TYR CG C Y N 296 TYR CD1 C Y N 297 TYR CD2 C Y N 298 TYR CE1 C Y N 299 TYR CE2 C Y N 300 TYR CZ C Y N 301 TYR OH O N N 302 TYR OXT O N N 303 TYR H H N N 304 TYR H2 H N N 305 TYR HA H N N 306 TYR HB2 H N N 307 TYR HB3 H N N 308 TYR HD1 H N N 309 TYR HD2 H N N 310 TYR HE1 H N N 311 TYR HE2 H N N 312 TYR HH H N N 313 TYR HXT H N N 314 VAL N N N N 315 VAL CA C N S 316 VAL C C N N 317 VAL O O N N 318 VAL CB C N N 319 VAL CG1 C N N 320 VAL CG2 C N N 321 VAL OXT O N N 322 VAL H H N N 323 VAL H2 H N N 324 VAL HA H N N 325 VAL HB H N N 326 VAL HG11 H N N 327 VAL HG12 H N N 328 VAL HG13 H N N 329 VAL HG21 H N N 330 VAL HG22 H N N 331 VAL HG23 H N N 332 VAL HXT H N N 333 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 MET N CA sing N N 190 MET N H sing N N 191 MET N H2 sing N N 192 MET CA C sing N N 193 MET CA CB sing N N 194 MET CA HA sing N N 195 MET C O doub N N 196 MET C OXT sing N N 197 MET CB CG sing N N 198 MET CB HB2 sing N N 199 MET CB HB3 sing N N 200 MET CG SD sing N N 201 MET CG HG2 sing N N 202 MET CG HG3 sing N N 203 MET SD CE sing N N 204 MET CE HE1 sing N N 205 MET CE HE2 sing N N 206 MET CE HE3 sing N N 207 MET OXT HXT sing N N 208 PHE N CA sing N N 209 PHE N H sing N N 210 PHE N H2 sing N N 211 PHE CA C sing N N 212 PHE CA CB sing N N 213 PHE CA HA sing N N 214 PHE C O doub N N 215 PHE C OXT sing N N 216 PHE CB CG sing N N 217 PHE CB HB2 sing N N 218 PHE CB HB3 sing N N 219 PHE CG CD1 doub Y N 220 PHE CG CD2 sing Y N 221 PHE CD1 CE1 sing Y N 222 PHE CD1 HD1 sing N N 223 PHE CD2 CE2 doub Y N 224 PHE CD2 HD2 sing N N 225 PHE CE1 CZ doub Y N 226 PHE CE1 HE1 sing N N 227 PHE CE2 CZ sing Y N 228 PHE CE2 HE2 sing N N 229 PHE CZ HZ sing N N 230 PHE OXT HXT sing N N 231 PRO N CA sing N N 232 PRO N CD sing N N 233 PRO N H sing N N 234 PRO CA C sing N N 235 PRO CA CB sing N N 236 PRO CA HA sing N N 237 PRO C O doub N N 238 PRO C OXT sing N N 239 PRO CB CG sing N N 240 PRO CB HB2 sing N N 241 PRO CB HB3 sing N N 242 PRO CG CD sing N N 243 PRO CG HG2 sing N N 244 PRO CG HG3 sing N N 245 PRO CD HD2 sing N N 246 PRO CD HD3 sing N N 247 PRO OXT HXT sing N N 248 SER N CA sing N N 249 SER N H sing N N 250 SER N H2 sing N N 251 SER CA C sing N N 252 SER CA CB sing N N 253 SER CA HA sing N N 254 SER C O doub N N 255 SER C OXT sing N N 256 SER CB OG sing N N 257 SER CB HB2 sing N N 258 SER CB HB3 sing N N 259 SER OG HG sing N N 260 SER OXT HXT sing N N 261 THR N CA sing N N 262 THR N H sing N N 263 THR N H2 sing N N 264 THR CA C sing N N 265 THR CA CB sing N N 266 THR CA HA sing N N 267 THR C O doub N N 268 THR C OXT sing N N 269 THR CB OG1 sing N N 270 THR CB CG2 sing N N 271 THR CB HB sing N N 272 THR OG1 HG1 sing N N 273 THR CG2 HG21 sing N N 274 THR CG2 HG22 sing N N 275 THR CG2 HG23 sing N N 276 THR OXT HXT sing N N 277 TYR N CA sing N N 278 TYR N H sing N N 279 TYR N H2 sing N N 280 TYR CA C sing N N 281 TYR CA CB sing N N 282 TYR CA HA sing N N 283 TYR C O doub N N 284 TYR C OXT sing N N 285 TYR CB CG sing N N 286 TYR CB HB2 sing N N 287 TYR CB HB3 sing N N 288 TYR CG CD1 doub Y N 289 TYR CG CD2 sing Y N 290 TYR CD1 CE1 sing Y N 291 TYR CD1 HD1 sing N N 292 TYR CD2 CE2 doub Y N 293 TYR CD2 HD2 sing N N 294 TYR CE1 CZ doub Y N 295 TYR CE1 HE1 sing N N 296 TYR CE2 CZ sing Y N 297 TYR CE2 HE2 sing N N 298 TYR CZ OH sing N N 299 TYR OH HH sing N N 300 TYR OXT HXT sing N N 301 VAL N CA sing N N 302 VAL N H sing N N 303 VAL N H2 sing N N 304 VAL CA C sing N N 305 VAL CA CB sing N N 306 VAL CA HA sing N N 307 VAL C O doub N N 308 VAL C OXT sing N N 309 VAL CB CG1 sing N N 310 VAL CB CG2 sing N N 311 VAL CB HB sing N N 312 VAL CG1 HG11 sing N N 313 VAL CG1 HG12 sing N N 314 VAL CG1 HG13 sing N N 315 VAL CG2 HG21 sing N N 316 VAL CG2 HG22 sing N N 317 VAL CG2 HG23 sing N N 318 VAL OXT HXT sing N N 319 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 700 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2NBU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_