data_2ND5 # _entry.id 2ND5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104715 RCSB ? ? 2ND5 PDB pdb_00002nd5 10.2210/pdb2nd5/pdb 26047 BMRB ? 10.13018/BMR26047 D_1000104715 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2017-05-17 ? 2 'Structure model' 1 1 2025-03-26 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_modification_feature 6 2 'Structure model' pdbx_nmr_spectrometer 7 2 'Structure model' struct_conn 8 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_spectrometer.model' 4 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 2 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2ND5 _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2016-05-05 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_id 26047 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hattori, Y.' 1 'Sebera, J.' 2 'Sychrovsky, V.' 3 'Furuita, K.' 4 'Sugiki, T.' 5 'Ohki, I.' 6 'Ikegami, T.' 7 'Kobayashi, N.' 8 'Tanaka, Y.' 9 'Fujiwara, T.' 10 'Kojima, C.' 11 # _citation.id primary _citation.title 'NMR Observation of Protein Surface Salt Bridges at Neutral pH' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hattori, Y.' 1 ? primary 'Sebera, J.' 2 ? primary 'Sychrovsky, V.' 3 ? primary 'Furuita, K.' 4 ? primary 'Sugiki, T.' 5 ? primary 'Ohki, I.' 6 ? primary 'Ikegami, T.' 7 ? primary 'Kobayashi, N.' 8 ? primary 'Tanaka, Y.' 9 ? primary 'Fujiwara, T.' 10 ? primary 'Kojima, C.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Peptidyl-prolyl cis-trans isomerase FKBP1A' _entity.formula_weight 12425.317 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 5.2.1.8 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FKBP-12, Immunophilin FKBP12' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GPSMGVQVETISPGDGRTFP(MLY)RGQTCVVHYTGMLEDG(MLY)(MLY)FDSSRDRN(MLY)PF(MLY)FMLG(MLY) QEVIRGWEEGVAQMSVGQRA(MLY)LTISPDYAYGATGHPGIIPPHATLVFDVELL(MLY)LE ; _entity_poly.pdbx_seq_one_letter_code_can ;GPSMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTI SPDYAYGATGHPGIIPPHATLVFDVELLKLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 SER n 1 4 MET n 1 5 GLY n 1 6 VAL n 1 7 GLN n 1 8 VAL n 1 9 GLU n 1 10 THR n 1 11 ILE n 1 12 SER n 1 13 PRO n 1 14 GLY n 1 15 ASP n 1 16 GLY n 1 17 ARG n 1 18 THR n 1 19 PHE n 1 20 PRO n 1 21 MLY n 1 22 ARG n 1 23 GLY n 1 24 GLN n 1 25 THR n 1 26 CYS n 1 27 VAL n 1 28 VAL n 1 29 HIS n 1 30 TYR n 1 31 THR n 1 32 GLY n 1 33 MET n 1 34 LEU n 1 35 GLU n 1 36 ASP n 1 37 GLY n 1 38 MLY n 1 39 MLY n 1 40 PHE n 1 41 ASP n 1 42 SER n 1 43 SER n 1 44 ARG n 1 45 ASP n 1 46 ARG n 1 47 ASN n 1 48 MLY n 1 49 PRO n 1 50 PHE n 1 51 MLY n 1 52 PHE n 1 53 MET n 1 54 LEU n 1 55 GLY n 1 56 MLY n 1 57 GLN n 1 58 GLU n 1 59 VAL n 1 60 ILE n 1 61 ARG n 1 62 GLY n 1 63 TRP n 1 64 GLU n 1 65 GLU n 1 66 GLY n 1 67 VAL n 1 68 ALA n 1 69 GLN n 1 70 MET n 1 71 SER n 1 72 VAL n 1 73 GLY n 1 74 GLN n 1 75 ARG n 1 76 ALA n 1 77 MLY n 1 78 LEU n 1 79 THR n 1 80 ILE n 1 81 SER n 1 82 PRO n 1 83 ASP n 1 84 TYR n 1 85 ALA n 1 86 TYR n 1 87 GLY n 1 88 ALA n 1 89 THR n 1 90 GLY n 1 91 HIS n 1 92 PRO n 1 93 GLY n 1 94 ILE n 1 95 ILE n 1 96 PRO n 1 97 PRO n 1 98 HIS n 1 99 ALA n 1 100 THR n 1 101 LEU n 1 102 VAL n 1 103 PHE n 1 104 ASP n 1 105 VAL n 1 106 GLU n 1 107 LEU n 1 108 LEU n 1 109 MLY n 1 110 LEU n 1 111 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FKBP1A, FKBP1, FKBP12' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pGEX _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MLY 'L-peptide linking' n N-DIMETHYL-LYSINE ? 'C8 H18 N2 O2' 174.241 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 -3 GLY GLY A . n A 1 2 PRO 2 -2 -2 PRO PRO A . n A 1 3 SER 3 -1 -1 SER SER A . n A 1 4 MET 4 0 0 MET MET A . n A 1 5 GLY 5 1 1 GLY GLY A . n A 1 6 VAL 6 2 2 VAL VAL A . n A 1 7 GLN 7 3 3 GLN GLN A . n A 1 8 VAL 8 4 4 VAL VAL A . n A 1 9 GLU 9 5 5 GLU GLU A . n A 1 10 THR 10 6 6 THR THR A . n A 1 11 ILE 11 7 7 ILE ILE A . n A 1 12 SER 12 8 8 SER SER A . n A 1 13 PRO 13 9 9 PRO PRO A . n A 1 14 GLY 14 10 10 GLY GLY A . n A 1 15 ASP 15 11 11 ASP ASP A . n A 1 16 GLY 16 12 12 GLY GLY A . n A 1 17 ARG 17 13 13 ARG ARG A . n A 1 18 THR 18 14 14 THR THR A . n A 1 19 PHE 19 15 15 PHE PHE A . n A 1 20 PRO 20 16 16 PRO PRO A . n A 1 21 MLY 21 17 17 MLY MLY A . n A 1 22 ARG 22 18 18 ARG ARG A . n A 1 23 GLY 23 19 19 GLY GLY A . n A 1 24 GLN 24 20 20 GLN GLN A . n A 1 25 THR 25 21 21 THR THR A . n A 1 26 CYS 26 22 22 CYS CYS A . n A 1 27 VAL 27 23 23 VAL VAL A . n A 1 28 VAL 28 24 24 VAL VAL A . n A 1 29 HIS 29 25 25 HIS HIS A . n A 1 30 TYR 30 26 26 TYR TYR A . n A 1 31 THR 31 27 27 THR THR A . n A 1 32 GLY 32 28 28 GLY GLY A . n A 1 33 MET 33 29 29 MET MET A . n A 1 34 LEU 34 30 30 LEU LEU A . n A 1 35 GLU 35 31 31 GLU GLU A . n A 1 36 ASP 36 32 32 ASP ASP A . n A 1 37 GLY 37 33 33 GLY GLY A . n A 1 38 MLY 38 34 34 MLY MLY A . n A 1 39 MLY 39 35 35 MLY MLY A . n A 1 40 PHE 40 36 36 PHE PHE A . n A 1 41 ASP 41 37 37 ASP ASP A . n A 1 42 SER 42 38 38 SER SER A . n A 1 43 SER 43 39 39 SER SER A . n A 1 44 ARG 44 40 40 ARG ARG A . n A 1 45 ASP 45 41 41 ASP ASP A . n A 1 46 ARG 46 42 42 ARG ARG A . n A 1 47 ASN 47 43 43 ASN ASN A . n A 1 48 MLY 48 44 44 MLY MLY A . n A 1 49 PRO 49 45 45 PRO PRO A . n A 1 50 PHE 50 46 46 PHE PHE A . n A 1 51 MLY 51 47 47 MLY MLY A . n A 1 52 PHE 52 48 48 PHE PHE A . n A 1 53 MET 53 49 49 MET MET A . n A 1 54 LEU 54 50 50 LEU LEU A . n A 1 55 GLY 55 51 51 GLY GLY A . n A 1 56 MLY 56 52 52 MLY MLY A . n A 1 57 GLN 57 53 53 GLN GLN A . n A 1 58 GLU 58 54 54 GLU GLU A . n A 1 59 VAL 59 55 55 VAL VAL A . n A 1 60 ILE 60 56 56 ILE ILE A . n A 1 61 ARG 61 57 57 ARG ARG A . n A 1 62 GLY 62 58 58 GLY GLY A . n A 1 63 TRP 63 59 59 TRP TRP A . n A 1 64 GLU 64 60 60 GLU GLU A . n A 1 65 GLU 65 61 61 GLU GLU A . n A 1 66 GLY 66 62 62 GLY GLY A . n A 1 67 VAL 67 63 63 VAL VAL A . n A 1 68 ALA 68 64 64 ALA ALA A . n A 1 69 GLN 69 65 65 GLN GLN A . n A 1 70 MET 70 66 66 MET MET A . n A 1 71 SER 71 67 67 SER SER A . n A 1 72 VAL 72 68 68 VAL VAL A . n A 1 73 GLY 73 69 69 GLY GLY A . n A 1 74 GLN 74 70 70 GLN GLN A . n A 1 75 ARG 75 71 71 ARG ARG A . n A 1 76 ALA 76 72 72 ALA ALA A . n A 1 77 MLY 77 73 73 MLY MLY A . n A 1 78 LEU 78 74 74 LEU LEU A . n A 1 79 THR 79 75 75 THR THR A . n A 1 80 ILE 80 76 76 ILE ILE A . n A 1 81 SER 81 77 77 SER SER A . n A 1 82 PRO 82 78 78 PRO PRO A . n A 1 83 ASP 83 79 79 ASP ASP A . n A 1 84 TYR 84 80 80 TYR TYR A . n A 1 85 ALA 85 81 81 ALA ALA A . n A 1 86 TYR 86 82 82 TYR TYR A . n A 1 87 GLY 87 83 83 GLY GLY A . n A 1 88 ALA 88 84 84 ALA ALA A . n A 1 89 THR 89 85 85 THR THR A . n A 1 90 GLY 90 86 86 GLY GLY A . n A 1 91 HIS 91 87 87 HIS HIS A . n A 1 92 PRO 92 88 88 PRO PRO A . n A 1 93 GLY 93 89 89 GLY GLY A . n A 1 94 ILE 94 90 90 ILE ILE A . n A 1 95 ILE 95 91 91 ILE ILE A . n A 1 96 PRO 96 92 92 PRO PRO A . n A 1 97 PRO 97 93 93 PRO PRO A . n A 1 98 HIS 98 94 94 HIS HIS A . n A 1 99 ALA 99 95 95 ALA ALA A . n A 1 100 THR 100 96 96 THR THR A . n A 1 101 LEU 101 97 97 LEU LEU A . n A 1 102 VAL 102 98 98 VAL VAL A . n A 1 103 PHE 103 99 99 PHE PHE A . n A 1 104 ASP 104 100 100 ASP ASP A . n A 1 105 VAL 105 101 101 VAL VAL A . n A 1 106 GLU 106 102 102 GLU GLU A . n A 1 107 LEU 107 103 103 LEU LEU A . n A 1 108 LEU 108 104 104 LEU LEU A . n A 1 109 MLY 109 105 105 MLY MLY A . n A 1 110 LEU 110 106 106 LEU LEU A . n A 1 111 GLU 111 107 107 GLU GLU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2ND5 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2ND5 _struct.title 'Lysine dimethylated FKBP12' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ND5 _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'lysine, salt bridge, methylation, ISOMERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FKB1A_HUMAN _struct_ref.pdbx_db_accession P62942 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPD YAYGATGHPGIIPPHATLVFDVELLKLE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ND5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 111 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62942 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 107 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ND5 GLY A 1 ? UNP P62942 ? ? 'expression tag' -3 1 1 2ND5 PRO A 2 ? UNP P62942 ? ? 'expression tag' -2 2 1 2ND5 SER A 3 ? UNP P62942 ? ? 'expression tag' -1 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 44 ? ASN A 47 ? ARG A 40 ASN A 43 5 ? 4 HELX_P HELX_P2 2 ILE A 60 ? VAL A 67 ? ILE A 56 VAL A 63 1 ? 8 HELX_P HELX_P3 3 ALA A 68 ? MET A 70 ? ALA A 64 MET A 66 5 ? 3 HELX_P HELX_P4 4 SER A 81 ? TYR A 86 ? SER A 77 TYR A 82 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A PRO 20 C ? ? ? 1_555 A MLY 21 N ? ? A PRO 16 A MLY 17 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale2 covale both ? A MLY 21 C ? ? ? 1_555 A ARG 22 N ? ? A MLY 17 A ARG 18 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale3 covale both ? A GLY 37 C ? ? ? 1_555 A MLY 38 N ? ? A GLY 33 A MLY 34 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale4 covale both ? A MLY 38 C ? ? ? 1_555 A MLY 39 N ? ? A MLY 34 A MLY 35 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale5 covale both ? A MLY 39 C ? ? ? 1_555 A PHE 40 N ? ? A MLY 35 A PHE 36 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale6 covale both ? A ASN 47 C ? ? ? 1_555 A MLY 48 N ? ? A ASN 43 A MLY 44 1_555 ? ? ? ? ? ? ? 1.346 ? ? covale7 covale both ? A MLY 48 C ? ? ? 1_555 A PRO 49 N ? ? A MLY 44 A PRO 45 1_555 ? ? ? ? ? ? ? 1.370 ? ? covale8 covale both ? A PHE 50 C ? ? ? 1_555 A MLY 51 N ? ? A PHE 46 A MLY 47 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale9 covale both ? A MLY 51 C ? ? ? 1_555 A PHE 52 N ? ? A MLY 47 A PHE 48 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale10 covale both ? A GLY 55 C ? ? ? 1_555 A MLY 56 N ? ? A GLY 51 A MLY 52 1_555 ? ? ? ? ? ? ? 1.345 ? ? covale11 covale both ? A MLY 56 C ? ? ? 1_555 A GLN 57 N ? ? A MLY 52 A GLN 53 1_555 ? ? ? ? ? ? ? 1.350 ? ? covale12 covale both ? A ALA 76 C ? ? ? 1_555 A MLY 77 N ? ? A ALA 72 A MLY 73 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale13 covale both ? A MLY 77 C ? ? ? 1_555 A LEU 78 N ? ? A MLY 73 A LEU 74 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale14 covale both ? A LEU 108 C ? ? ? 1_555 A MLY 109 N ? ? A LEU 104 A MLY 105 1_555 ? ? ? ? ? ? ? 1.345 ? ? covale15 covale both ? A MLY 109 C ? ? ? 1_555 A LEU 110 N ? ? A MLY 105 A LEU 106 1_555 ? ? ? ? ? ? ? 1.336 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MLY A 21 ? . . . . MLY A 17 ? 1_555 . . . . . . . LYS 1 MLY Methylation 'Named protein modification' 2 MLY A 38 ? . . . . MLY A 34 ? 1_555 . . . . . . . LYS 1 MLY Methylation 'Named protein modification' 3 MLY A 39 ? . . . . MLY A 35 ? 1_555 . . . . . . . LYS 1 MLY Methylation 'Named protein modification' 4 MLY A 48 ? . . . . MLY A 44 ? 1_555 . . . . . . . LYS 1 MLY Methylation 'Named protein modification' 5 MLY A 51 ? . . . . MLY A 47 ? 1_555 . . . . . . . LYS 1 MLY Methylation 'Named protein modification' 6 MLY A 56 ? . . . . MLY A 52 ? 1_555 . . . . . . . LYS 1 MLY Methylation 'Named protein modification' 7 MLY A 77 ? . . . . MLY A 73 ? 1_555 . . . . . . . LYS 1 MLY Methylation 'Named protein modification' 8 MLY A 109 ? . . . . MLY A 105 ? 1_555 . . . . . . . LYS 1 MLY Methylation 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 6 ? SER A 12 ? VAL A 2 SER A 8 A 2 ARG A 75 ? ILE A 80 ? ARG A 71 ILE A 76 A 3 LEU A 101 ? LEU A 110 ? LEU A 97 LEU A 106 A 4 THR A 31 ? LEU A 34 ? THR A 27 LEU A 30 A 5 MLY A 39 ? SER A 42 ? MLY A 35 SER A 38 B 1 VAL A 6 ? SER A 12 ? VAL A 2 SER A 8 B 2 ARG A 75 ? ILE A 80 ? ARG A 71 ILE A 76 B 3 LEU A 101 ? LEU A 110 ? LEU A 97 LEU A 106 B 4 THR A 25 ? HIS A 29 ? THR A 21 HIS A 25 B 5 PHE A 50 ? MET A 53 ? PHE A 46 MET A 49 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 11 ? N ILE A 7 O ARG A 75 ? O ARG A 71 A 2 3 N ILE A 80 ? N ILE A 76 O LEU A 101 ? O LEU A 97 A 3 4 O VAL A 102 ? O VAL A 98 N MET A 33 ? N MET A 29 A 4 5 N GLY A 32 ? N GLY A 28 O ASP A 41 ? O ASP A 37 B 1 2 N ILE A 11 ? N ILE A 7 O ARG A 75 ? O ARG A 71 B 2 3 N ILE A 80 ? N ILE A 76 O LEU A 101 ? O LEU A 97 B 3 4 O MLY A 109 ? O MLY A 105 N VAL A 27 ? N VAL A 23 B 4 5 N VAL A 28 ? N VAL A 24 O PHE A 50 ? O PHE A 46 # _pdbx_entry_details.entry_id 2ND5 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A -1 ? ? 62.87 126.56 2 1 MET A 0 ? ? 63.13 125.86 3 1 LEU A 30 ? ? -57.53 172.01 4 1 ASP A 37 ? ? -179.58 110.50 5 1 TYR A 82 ? ? -134.21 -51.21 6 1 THR A 85 ? ? -100.44 -60.35 7 2 SER A -1 ? ? -131.43 -47.84 8 2 MET A 0 ? ? -135.95 -45.81 9 2 LEU A 30 ? ? -56.16 172.12 10 2 ASP A 37 ? ? 176.54 111.47 11 2 TYR A 82 ? ? -132.61 -53.46 12 2 THR A 85 ? ? -100.10 -60.38 13 3 LEU A 30 ? ? -56.25 170.42 14 3 ASP A 37 ? ? 175.50 111.36 15 3 TYR A 82 ? ? 75.25 -50.70 16 3 THR A 85 ? ? -97.88 -60.19 17 4 MET A 0 ? ? 46.52 125.58 18 4 LEU A 30 ? ? -57.31 170.85 19 4 ASP A 37 ? ? -167.18 111.54 20 4 TYR A 82 ? ? -134.55 -51.98 21 4 THR A 85 ? ? -100.21 -60.37 22 5 LEU A 30 ? ? -57.25 171.10 23 5 ASP A 37 ? ? -166.81 111.62 24 5 TYR A 82 ? ? -135.10 -52.09 25 5 THR A 85 ? ? -100.07 -60.32 26 6 SER A -1 ? ? 63.69 137.48 27 6 LEU A 30 ? ? -58.50 170.96 28 6 ASP A 37 ? ? -165.46 111.55 29 6 TYR A 82 ? ? -133.85 -54.00 30 6 THR A 85 ? ? -100.63 -60.33 31 7 SER A -1 ? ? 61.91 118.37 32 7 LEU A 30 ? ? -57.50 170.77 33 7 ASP A 37 ? ? -161.68 111.51 34 7 TYR A 82 ? ? -134.81 -52.71 35 7 THR A 85 ? ? -100.03 -60.23 36 8 LEU A 30 ? ? -57.19 172.12 37 8 ASP A 37 ? ? 179.98 110.45 38 8 TYR A 82 ? ? -133.46 -50.99 39 8 THR A 85 ? ? -99.51 -60.33 40 9 LEU A 30 ? ? -57.04 170.18 41 9 ASP A 37 ? ? -160.89 111.47 42 9 TYR A 82 ? ? -134.59 -52.51 43 9 THR A 85 ? ? -100.10 -60.33 44 10 LEU A 30 ? ? -55.52 171.83 45 10 ASP A 37 ? ? 177.00 111.34 46 10 TYR A 82 ? ? -132.17 -53.66 47 10 THR A 85 ? ? -100.13 -60.38 48 11 LEU A 30 ? ? -57.18 172.03 49 11 ASP A 37 ? ? -179.70 110.50 50 11 GLN A 53 ? ? 70.17 30.95 51 11 TYR A 82 ? ? -133.68 -51.02 52 11 THR A 85 ? ? -99.54 -60.38 53 12 MET A 0 ? ? 71.09 -49.08 54 12 LEU A 30 ? ? -57.04 170.12 55 12 ASP A 37 ? ? -161.62 111.54 56 12 TYR A 82 ? ? -133.51 -52.43 57 12 THR A 85 ? ? -100.29 -60.36 58 13 LEU A 30 ? ? -54.79 170.53 59 13 ASP A 37 ? ? 170.84 115.97 60 13 ALA A 84 ? ? 64.38 -12.43 61 13 THR A 85 ? ? -98.26 -60.22 62 14 SER A -1 ? ? 63.25 128.94 63 14 LEU A 30 ? ? -58.49 172.29 64 14 ASP A 37 ? ? 179.18 110.96 65 14 TYR A 82 ? ? -133.31 -51.16 66 14 THR A 85 ? ? -99.51 -60.39 67 15 LEU A 30 ? ? -57.96 171.53 68 15 ASP A 37 ? ? -163.44 111.57 69 15 TYR A 82 ? ? -133.52 -53.85 70 15 THR A 85 ? ? -102.63 -60.38 71 16 LEU A 30 ? ? -57.62 170.90 72 16 ASP A 37 ? ? -166.55 111.59 73 16 TYR A 82 ? ? -134.96 -52.48 74 16 THR A 85 ? ? -100.12 -60.43 75 17 LEU A 30 ? ? -56.38 172.34 76 17 ASP A 37 ? ? 175.80 110.70 77 17 TYR A 82 ? ? -134.43 -50.85 78 17 THR A 85 ? ? -100.02 -60.38 79 18 LEU A 30 ? ? -54.74 171.41 80 18 ASP A 37 ? ? 176.16 111.15 81 18 TYR A 82 ? ? -134.50 -50.84 82 18 THR A 85 ? ? -99.53 -60.38 83 19 SER A -1 ? ? 61.74 119.58 84 19 LEU A 30 ? ? -57.23 170.41 85 19 ASP A 37 ? ? -161.55 111.63 86 19 TYR A 82 ? ? -134.94 -51.99 87 19 THR A 85 ? ? -100.06 -60.36 88 20 LEU A 30 ? ? -58.50 171.40 89 20 ASP A 37 ? ? -160.98 113.42 90 20 TYR A 82 ? ? -133.40 -52.08 91 20 THR A 85 ? ? -100.61 -60.37 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MLY 21 A MLY 17 ? LYS N-DIMETHYL-LYSINE 2 A MLY 38 A MLY 34 ? LYS N-DIMETHYL-LYSINE 3 A MLY 39 A MLY 35 ? LYS N-DIMETHYL-LYSINE 4 A MLY 48 A MLY 44 ? LYS N-DIMETHYL-LYSINE 5 A MLY 51 A MLY 47 ? LYS N-DIMETHYL-LYSINE 6 A MLY 56 A MLY 52 ? LYS N-DIMETHYL-LYSINE 7 A MLY 77 A MLY 73 ? LYS N-DIMETHYL-LYSINE 8 A MLY 109 A MLY 105 ? LYS N-DIMETHYL-LYSINE # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2ND5 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 2.4 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 6.0 _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2ND5 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1.2 mM [U-99% 13C; U-99% 15N] entity-1, 30 mM sodium chloride-2, 3 mM DTT-3, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1.2 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium chloride-2' 30 ? mM ? 1 DTT-3 3 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '2D 1H-1H NOESY' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HNCACB' 1 7 1 '3D HN(CA)CO' 1 8 1 '3D HNCO' 1 9 1 '3D HBHA(CO)NH' 1 10 1 '3D C(CO)NH' 1 11 1 '3D H(CCO)NH' 1 12 1 '3D HCCH-TOCSY' 1 13 1 '3D 1H-15N TOCSY' 1 14 1 '3D 1H-15N NOESY' 1 15 1 '3D 1H-13C NOESY aliphatic' 1 16 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2ND5 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 3557 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count 1461 _pdbx_nmr_constraints.NOE_medium_range_total_count 555 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2ND5 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 1 ? 'Kobayashi, Naohiro' 'peak picking' MagRO-NMRView 2 ? 'Kobayashi, Naohiro' 'chemical shift assignment' MagRO-NMRView 3 ? 'Kobayashi, Naohiro' 'data analysis' MagRO-NMRView 4 ? 'Guntert, Mumenthaler and Wuthrich' 'chemical shift assignment' CYANA 5 2.1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 6 2.1 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 7 ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 8 ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 MET N N N N 202 MET CA C N S 203 MET C C N N 204 MET O O N N 205 MET CB C N N 206 MET CG C N N 207 MET SD S N N 208 MET CE C N N 209 MET OXT O N N 210 MET H H N N 211 MET H2 H N N 212 MET HA H N N 213 MET HB2 H N N 214 MET HB3 H N N 215 MET HG2 H N N 216 MET HG3 H N N 217 MET HE1 H N N 218 MET HE2 H N N 219 MET HE3 H N N 220 MET HXT H N N 221 MLY N N N N 222 MLY CA C N S 223 MLY CB C N N 224 MLY CG C N N 225 MLY CD C N N 226 MLY CE C N N 227 MLY NZ N N N 228 MLY CH1 C N N 229 MLY CH2 C N N 230 MLY C C N N 231 MLY O O N N 232 MLY OXT O N N 233 MLY H H N N 234 MLY H2 H N N 235 MLY HA H N N 236 MLY HB2 H N N 237 MLY HB3 H N N 238 MLY HG2 H N N 239 MLY HG3 H N N 240 MLY HD2 H N N 241 MLY HD3 H N N 242 MLY HE2 H N N 243 MLY HE3 H N N 244 MLY HH11 H N N 245 MLY HH12 H N N 246 MLY HH13 H N N 247 MLY HH21 H N N 248 MLY HH22 H N N 249 MLY HH23 H N N 250 MLY HXT H N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 MET N CA sing N N 192 MET N H sing N N 193 MET N H2 sing N N 194 MET CA C sing N N 195 MET CA CB sing N N 196 MET CA HA sing N N 197 MET C O doub N N 198 MET C OXT sing N N 199 MET CB CG sing N N 200 MET CB HB2 sing N N 201 MET CB HB3 sing N N 202 MET CG SD sing N N 203 MET CG HG2 sing N N 204 MET CG HG3 sing N N 205 MET SD CE sing N N 206 MET CE HE1 sing N N 207 MET CE HE2 sing N N 208 MET CE HE3 sing N N 209 MET OXT HXT sing N N 210 MLY N CA sing N N 211 MLY N H sing N N 212 MLY N H2 sing N N 213 MLY CA CB sing N N 214 MLY CA C sing N N 215 MLY CA HA sing N N 216 MLY CB CG sing N N 217 MLY CB HB2 sing N N 218 MLY CB HB3 sing N N 219 MLY CG CD sing N N 220 MLY CG HG2 sing N N 221 MLY CG HG3 sing N N 222 MLY CD CE sing N N 223 MLY CD HD2 sing N N 224 MLY CD HD3 sing N N 225 MLY CE NZ sing N N 226 MLY CE HE2 sing N N 227 MLY CE HE3 sing N N 228 MLY NZ CH1 sing N N 229 MLY NZ CH2 sing N N 230 MLY CH1 HH11 sing N N 231 MLY CH1 HH12 sing N N 232 MLY CH1 HH13 sing N N 233 MLY CH2 HH21 sing N N 234 MLY CH2 HH22 sing N N 235 MLY CH2 HH23 sing N N 236 MLY C O doub N N 237 MLY C OXT sing N N 238 MLY OXT HXT sing N N 239 PHE N CA sing N N 240 PHE N H sing N N 241 PHE N H2 sing N N 242 PHE CA C sing N N 243 PHE CA CB sing N N 244 PHE CA HA sing N N 245 PHE C O doub N N 246 PHE C OXT sing N N 247 PHE CB CG sing N N 248 PHE CB HB2 sing N N 249 PHE CB HB3 sing N N 250 PHE CG CD1 doub Y N 251 PHE CG CD2 sing Y N 252 PHE CD1 CE1 sing Y N 253 PHE CD1 HD1 sing N N 254 PHE CD2 CE2 doub Y N 255 PHE CD2 HD2 sing N N 256 PHE CE1 CZ doub Y N 257 PHE CE1 HE1 sing N N 258 PHE CE2 CZ sing Y N 259 PHE CE2 HE2 sing N N 260 PHE CZ HZ sing N N 261 PHE OXT HXT sing N N 262 PRO N CA sing N N 263 PRO N CD sing N N 264 PRO N H sing N N 265 PRO CA C sing N N 266 PRO CA CB sing N N 267 PRO CA HA sing N N 268 PRO C O doub N N 269 PRO C OXT sing N N 270 PRO CB CG sing N N 271 PRO CB HB2 sing N N 272 PRO CB HB3 sing N N 273 PRO CG CD sing N N 274 PRO CG HG2 sing N N 275 PRO CG HG3 sing N N 276 PRO CD HD2 sing N N 277 PRO CD HD3 sing N N 278 PRO OXT HXT sing N N 279 SER N CA sing N N 280 SER N H sing N N 281 SER N H2 sing N N 282 SER CA C sing N N 283 SER CA CB sing N N 284 SER CA HA sing N N 285 SER C O doub N N 286 SER C OXT sing N N 287 SER CB OG sing N N 288 SER CB HB2 sing N N 289 SER CB HB3 sing N N 290 SER OG HG sing N N 291 SER OXT HXT sing N N 292 THR N CA sing N N 293 THR N H sing N N 294 THR N H2 sing N N 295 THR CA C sing N N 296 THR CA CB sing N N 297 THR CA HA sing N N 298 THR C O doub N N 299 THR C OXT sing N N 300 THR CB OG1 sing N N 301 THR CB CG2 sing N N 302 THR CB HB sing N N 303 THR OG1 HG1 sing N N 304 THR CG2 HG21 sing N N 305 THR CG2 HG22 sing N N 306 THR CG2 HG23 sing N N 307 THR OXT HXT sing N N 308 TRP N CA sing N N 309 TRP N H sing N N 310 TRP N H2 sing N N 311 TRP CA C sing N N 312 TRP CA CB sing N N 313 TRP CA HA sing N N 314 TRP C O doub N N 315 TRP C OXT sing N N 316 TRP CB CG sing N N 317 TRP CB HB2 sing N N 318 TRP CB HB3 sing N N 319 TRP CG CD1 doub Y N 320 TRP CG CD2 sing Y N 321 TRP CD1 NE1 sing Y N 322 TRP CD1 HD1 sing N N 323 TRP CD2 CE2 doub Y N 324 TRP CD2 CE3 sing Y N 325 TRP NE1 CE2 sing Y N 326 TRP NE1 HE1 sing N N 327 TRP CE2 CZ2 sing Y N 328 TRP CE3 CZ3 doub Y N 329 TRP CE3 HE3 sing N N 330 TRP CZ2 CH2 doub Y N 331 TRP CZ2 HZ2 sing N N 332 TRP CZ3 CH2 sing Y N 333 TRP CZ3 HZ3 sing N N 334 TRP CH2 HH2 sing N N 335 TRP OXT HXT sing N N 336 TYR N CA sing N N 337 TYR N H sing N N 338 TYR N H2 sing N N 339 TYR CA C sing N N 340 TYR CA CB sing N N 341 TYR CA HA sing N N 342 TYR C O doub N N 343 TYR C OXT sing N N 344 TYR CB CG sing N N 345 TYR CB HB2 sing N N 346 TYR CB HB3 sing N N 347 TYR CG CD1 doub Y N 348 TYR CG CD2 sing Y N 349 TYR CD1 CE1 sing Y N 350 TYR CD1 HD1 sing N N 351 TYR CD2 CE2 doub Y N 352 TYR CD2 HD2 sing N N 353 TYR CE1 CZ doub Y N 354 TYR CE1 HE1 sing N N 355 TYR CE2 CZ sing Y N 356 TYR CE2 HE2 sing N N 357 TYR CZ OH sing N N 358 TYR OH HH sing N N 359 TYR OXT HXT sing N N 360 VAL N CA sing N N 361 VAL N H sing N N 362 VAL N H2 sing N N 363 VAL CA C sing N N 364 VAL CA CB sing N N 365 VAL CA HA sing N N 366 VAL C O doub N N 367 VAL C OXT sing N N 368 VAL CB CG1 sing N N 369 VAL CB CG2 sing N N 370 VAL CB HB sing N N 371 VAL CG1 HG11 sing N N 372 VAL CG1 HG12 sing N N 373 VAL CG1 HG13 sing N N 374 VAL CG2 HG21 sing N N 375 VAL CG2 HG22 sing N N 376 VAL CG2 HG23 sing N N 377 VAL OXT HXT sing N N 378 # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance III' # _atom_sites.entry_id 2ND5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #