data_2NDI # _entry.id 2NDI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104728 RCSB ? ? 2NDI PDB pdb_00002ndi 10.2210/pdb2ndi/pdb 26062 BMRB ? 10.13018/BMR26062 D_1000104728 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-07 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 9 3 'Structure model' pdbx_entry_details 10 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2NDI _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2016-06-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 26062 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _audit_author.name 'Hu, K.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'A sodium channel inhibitor ISTX-I with a novel structure provides a new hint at the evolutionary link between two toxin folds.' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 6 _citation.page_first 29691 _citation.page_last 29691 _citation.year 2016 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27407029 _citation.pdbx_database_id_DOI 10.1038/srep29691 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rong, M.' 1 ? primary 'Liu, J.' 2 ? primary 'Zhang, M.' 3 ? primary 'Wang, G.' 4 ? primary 'Zhao, G.' 5 ? primary 'Wang, G.' 6 ? primary 'Zhang, Y.' 7 ? primary 'Hu, K.' 8 ? primary 'Lai, R.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative secreted salivary protein' _entity.formula_weight 4793.280 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP RESIDUES 42-86' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GLCSENGDCAADECCVDTVFEGDMVTRSCEKTTGNFTECPGLTPIA _entity_poly.pdbx_seq_one_letter_code_can GLCSENGDCAADECCVDTVFEGDMVTRSCEKTTGNFTECPGLTPIA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 CYS n 1 4 SER n 1 5 GLU n 1 6 ASN n 1 7 GLY n 1 8 ASP n 1 9 CYS n 1 10 ALA n 1 11 ALA n 1 12 ASP n 1 13 GLU n 1 14 CYS n 1 15 CYS n 1 16 VAL n 1 17 ASP n 1 18 THR n 1 19 VAL n 1 20 PHE n 1 21 GLU n 1 22 GLY n 1 23 ASP n 1 24 MET n 1 25 VAL n 1 26 THR n 1 27 ARG n 1 28 SER n 1 29 CYS n 1 30 GLU n 1 31 LYS n 1 32 THR n 1 33 THR n 1 34 GLY n 1 35 ASN n 1 36 PHE n 1 37 THR n 1 38 GLU n 1 39 CYS n 1 40 PRO n 1 41 GLY n 1 42 LEU n 1 43 THR n 1 44 PRO n 1 45 ILE n 1 46 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'blacklegged tick,deer tick,shoulder tick' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ixodes scapularis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6945 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector 'pET-32a (+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ALA 46 46 46 ALA ALA A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2NDI _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2NDI _struct.title 'Solution structure of the toxin ISTX-I from Ixodes scapularis' _struct.pdbx_model_details 'minimized average structure, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2NDI _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'toxin peptide, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q4PN35_IXOSC _struct_ref.pdbx_db_accession Q4PN35 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LCSENGDCAADECCVDTVFEGDMVTRSCEKTTGNFTECPGLTPIA _struct_ref.pdbx_align_begin 42 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2NDI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 46 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q4PN35 _struct_ref_seq.db_align_beg 42 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 86 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 46 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2NDI _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q4PN35 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 3 A CYS 15 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 9 A CYS 29 1_555 ? ? ? ? ? ? ? 2.011 ? ? disulf3 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 14 A CYS 39 1_555 ? ? ? ? ? ? ? 2.022 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 3 ? CYS A 15 ? CYS A 3 ? 1_555 CYS A 15 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 9 ? CYS A 29 ? CYS A 9 ? 1_555 CYS A 29 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 14 ? CYS A 39 ? CYS A 14 ? 1_555 CYS A 39 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 14 ? THR A 18 ? CYS A 14 THR A 18 A 2 THR A 26 ? GLU A 30 ? THR A 26 GLU A 30 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 18 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 18 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id THR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 26 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id THR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 26 # _pdbx_entry_details.entry_id 2NDI _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 17 _pdbx_validate_close_contact.auth_atom_id_1 H2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLY _pdbx_validate_close_contact.auth_seq_id_1 1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LEU _pdbx_validate_close_contact.auth_seq_id_2 2 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.29 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 19 ? ? 179.53 117.64 2 1 CYS A 29 ? ? -175.14 137.55 3 2 VAL A 19 ? ? 179.27 118.34 4 2 PHE A 20 ? ? -98.13 -64.06 5 2 CYS A 29 ? ? -172.09 116.26 6 2 THR A 33 ? ? -151.03 89.44 7 2 THR A 37 ? ? -129.50 -145.93 8 3 VAL A 19 ? ? 177.04 119.57 9 3 PHE A 20 ? ? -98.16 -65.94 10 3 CYS A 29 ? ? -171.92 101.56 11 3 THR A 33 ? ? -154.16 84.27 12 3 CYS A 39 ? ? -43.55 160.23 13 4 VAL A 19 ? ? -178.33 116.64 14 4 CYS A 29 ? ? -173.65 116.99 15 4 THR A 33 ? ? -153.01 82.68 16 5 VAL A 19 ? ? 177.00 119.25 17 5 PHE A 20 ? ? -93.61 -94.19 18 5 CYS A 29 ? ? -172.86 116.22 19 5 THR A 33 ? ? -151.31 88.85 20 5 THR A 37 ? ? -133.36 -144.84 21 6 ASP A 8 ? ? -48.29 -76.55 22 6 VAL A 19 ? ? -179.05 117.02 23 6 PHE A 20 ? ? -100.89 -63.85 24 6 CYS A 29 ? ? -175.01 117.62 25 6 THR A 33 ? ? -152.96 89.70 26 7 VAL A 19 ? ? 178.07 117.02 27 7 THR A 33 ? ? -78.40 45.20 28 7 THR A 37 ? ? -133.98 -150.28 29 8 VAL A 19 ? ? 176.18 118.39 30 8 PHE A 20 ? ? -98.03 -63.18 31 8 CYS A 29 ? ? -176.24 128.35 32 8 ILE A 45 ? ? -43.48 153.79 33 9 VAL A 19 ? ? 178.09 119.25 34 9 PHE A 20 ? ? -94.42 -95.01 35 9 CYS A 29 ? ? -175.42 130.86 36 10 SER A 4 ? ? 76.20 -33.13 37 10 VAL A 19 ? ? 176.38 119.56 38 10 PHE A 20 ? ? -95.24 -94.39 39 10 CYS A 29 ? ? -170.60 134.85 40 11 SER A 4 ? ? 74.18 -36.42 41 11 VAL A 19 ? ? 178.67 118.92 42 11 PHE A 20 ? ? -98.40 -92.07 43 11 THR A 33 ? ? -150.19 84.90 44 12 SER A 4 ? ? 75.53 -34.68 45 12 VAL A 19 ? ? 179.32 116.91 46 12 PHE A 20 ? ? -73.77 -92.63 47 12 GLU A 21 ? ? -90.22 -65.26 48 12 CYS A 29 ? ? -170.58 129.91 49 12 THR A 33 ? ? -151.43 85.08 50 13 VAL A 19 ? ? 178.38 117.28 51 13 PHE A 20 ? ? -103.97 -62.36 52 13 THR A 33 ? ? -154.77 88.28 53 13 THR A 37 ? ? -126.86 -145.71 54 13 ILE A 45 ? ? -37.99 144.88 55 14 VAL A 19 ? ? 178.41 118.17 56 14 PHE A 20 ? ? -90.03 -62.57 57 14 CYS A 29 ? ? -173.41 115.25 58 14 THR A 33 ? ? -152.21 82.49 59 15 VAL A 19 ? ? -178.77 116.92 60 15 CYS A 29 ? ? -169.36 114.89 61 15 CYS A 39 ? ? -41.08 164.40 62 16 VAL A 16 ? ? -165.87 117.98 63 16 VAL A 19 ? ? 177.72 119.52 64 16 PHE A 20 ? ? -94.19 -94.10 65 16 THR A 33 ? ? -154.05 89.43 66 16 THR A 37 ? ? -125.85 -144.96 67 17 SER A 4 ? ? 75.17 -32.66 68 17 VAL A 19 ? ? 179.54 117.01 69 17 PHE A 20 ? ? -104.12 -62.80 70 17 THR A 33 ? ? -152.29 88.81 71 17 THR A 37 ? ? -124.85 -145.20 72 18 GLU A 5 ? ? -153.10 47.46 73 18 ASN A 6 ? ? 60.18 -5.96 74 18 VAL A 19 ? ? 177.08 119.10 75 18 PHE A 20 ? ? -94.32 -95.09 76 18 CYS A 29 ? ? -172.57 115.16 77 18 THR A 33 ? ? -152.84 89.47 78 18 THR A 37 ? ? -127.70 -146.79 79 19 VAL A 19 ? ? -179.57 117.25 80 19 PHE A 20 ? ? -95.93 -62.18 81 19 CYS A 29 ? ? -172.90 115.78 82 19 THR A 33 ? ? -153.34 89.49 83 19 THR A 37 ? ? -134.52 -157.66 84 20 VAL A 19 ? ? 179.34 117.11 85 20 PHE A 20 ? ? -100.57 -71.19 86 20 THR A 33 ? ? -152.91 89.03 87 20 THR A 37 ? ? -132.77 -156.21 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2NDI _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2NDI _pdbx_nmr_representative.selection_criteria 'minimized average structure' # _pdbx_nmr_sample_details.contents '1mM ISTX-I-1, 8mM ISTX-I-2, 10mM MES-3, 20mM sodium chloride-4, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id ISTX-I-1 1 ? mM ? 1 ISTX-I-2 8 ? mM ? 1 MES-3 10 ? mM ? 1 'sodium chloride-4' 20 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.02 _pdbx_nmr_exptl_sample_conditions.pH 5.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-13C HSQC' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '2D TOCSY-HSQC' # _pdbx_nmr_refine.entry_id 2NDI _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 1 ? 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2 ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LEU N N N N 139 LEU CA C N S 140 LEU C C N N 141 LEU O O N N 142 LEU CB C N N 143 LEU CG C N N 144 LEU CD1 C N N 145 LEU CD2 C N N 146 LEU OXT O N N 147 LEU H H N N 148 LEU H2 H N N 149 LEU HA H N N 150 LEU HB2 H N N 151 LEU HB3 H N N 152 LEU HG H N N 153 LEU HD11 H N N 154 LEU HD12 H N N 155 LEU HD13 H N N 156 LEU HD21 H N N 157 LEU HD22 H N N 158 LEU HD23 H N N 159 LEU HXT H N N 160 LYS N N N N 161 LYS CA C N S 162 LYS C C N N 163 LYS O O N N 164 LYS CB C N N 165 LYS CG C N N 166 LYS CD C N N 167 LYS CE C N N 168 LYS NZ N N N 169 LYS OXT O N N 170 LYS H H N N 171 LYS H2 H N N 172 LYS HA H N N 173 LYS HB2 H N N 174 LYS HB3 H N N 175 LYS HG2 H N N 176 LYS HG3 H N N 177 LYS HD2 H N N 178 LYS HD3 H N N 179 LYS HE2 H N N 180 LYS HE3 H N N 181 LYS HZ1 H N N 182 LYS HZ2 H N N 183 LYS HZ3 H N N 184 LYS HXT H N N 185 MET N N N N 186 MET CA C N S 187 MET C C N N 188 MET O O N N 189 MET CB C N N 190 MET CG C N N 191 MET SD S N N 192 MET CE C N N 193 MET OXT O N N 194 MET H H N N 195 MET H2 H N N 196 MET HA H N N 197 MET HB2 H N N 198 MET HB3 H N N 199 MET HG2 H N N 200 MET HG3 H N N 201 MET HE1 H N N 202 MET HE2 H N N 203 MET HE3 H N N 204 MET HXT H N N 205 PHE N N N N 206 PHE CA C N S 207 PHE C C N N 208 PHE O O N N 209 PHE CB C N N 210 PHE CG C Y N 211 PHE CD1 C Y N 212 PHE CD2 C Y N 213 PHE CE1 C Y N 214 PHE CE2 C Y N 215 PHE CZ C Y N 216 PHE OXT O N N 217 PHE H H N N 218 PHE H2 H N N 219 PHE HA H N N 220 PHE HB2 H N N 221 PHE HB3 H N N 222 PHE HD1 H N N 223 PHE HD2 H N N 224 PHE HE1 H N N 225 PHE HE2 H N N 226 PHE HZ H N N 227 PHE HXT H N N 228 PRO N N N N 229 PRO CA C N S 230 PRO C C N N 231 PRO O O N N 232 PRO CB C N N 233 PRO CG C N N 234 PRO CD C N N 235 PRO OXT O N N 236 PRO H H N N 237 PRO HA H N N 238 PRO HB2 H N N 239 PRO HB3 H N N 240 PRO HG2 H N N 241 PRO HG3 H N N 242 PRO HD2 H N N 243 PRO HD3 H N N 244 PRO HXT H N N 245 SER N N N N 246 SER CA C N S 247 SER C C N N 248 SER O O N N 249 SER CB C N N 250 SER OG O N N 251 SER OXT O N N 252 SER H H N N 253 SER H2 H N N 254 SER HA H N N 255 SER HB2 H N N 256 SER HB3 H N N 257 SER HG H N N 258 SER HXT H N N 259 THR N N N N 260 THR CA C N S 261 THR C C N N 262 THR O O N N 263 THR CB C N R 264 THR OG1 O N N 265 THR CG2 C N N 266 THR OXT O N N 267 THR H H N N 268 THR H2 H N N 269 THR HA H N N 270 THR HB H N N 271 THR HG1 H N N 272 THR HG21 H N N 273 THR HG22 H N N 274 THR HG23 H N N 275 THR HXT H N N 276 VAL N N N N 277 VAL CA C N S 278 VAL C C N N 279 VAL O O N N 280 VAL CB C N N 281 VAL CG1 C N N 282 VAL CG2 C N N 283 VAL OXT O N N 284 VAL H H N N 285 VAL H2 H N N 286 VAL HA H N N 287 VAL HB H N N 288 VAL HG11 H N N 289 VAL HG12 H N N 290 VAL HG13 H N N 291 VAL HG21 H N N 292 VAL HG22 H N N 293 VAL HG23 H N N 294 VAL HXT H N N 295 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 ILE N CA sing N N 110 ILE N H sing N N 111 ILE N H2 sing N N 112 ILE CA C sing N N 113 ILE CA CB sing N N 114 ILE CA HA sing N N 115 ILE C O doub N N 116 ILE C OXT sing N N 117 ILE CB CG1 sing N N 118 ILE CB CG2 sing N N 119 ILE CB HB sing N N 120 ILE CG1 CD1 sing N N 121 ILE CG1 HG12 sing N N 122 ILE CG1 HG13 sing N N 123 ILE CG2 HG21 sing N N 124 ILE CG2 HG22 sing N N 125 ILE CG2 HG23 sing N N 126 ILE CD1 HD11 sing N N 127 ILE CD1 HD12 sing N N 128 ILE CD1 HD13 sing N N 129 ILE OXT HXT sing N N 130 LEU N CA sing N N 131 LEU N H sing N N 132 LEU N H2 sing N N 133 LEU CA C sing N N 134 LEU CA CB sing N N 135 LEU CA HA sing N N 136 LEU C O doub N N 137 LEU C OXT sing N N 138 LEU CB CG sing N N 139 LEU CB HB2 sing N N 140 LEU CB HB3 sing N N 141 LEU CG CD1 sing N N 142 LEU CG CD2 sing N N 143 LEU CG HG sing N N 144 LEU CD1 HD11 sing N N 145 LEU CD1 HD12 sing N N 146 LEU CD1 HD13 sing N N 147 LEU CD2 HD21 sing N N 148 LEU CD2 HD22 sing N N 149 LEU CD2 HD23 sing N N 150 LEU OXT HXT sing N N 151 LYS N CA sing N N 152 LYS N H sing N N 153 LYS N H2 sing N N 154 LYS CA C sing N N 155 LYS CA CB sing N N 156 LYS CA HA sing N N 157 LYS C O doub N N 158 LYS C OXT sing N N 159 LYS CB CG sing N N 160 LYS CB HB2 sing N N 161 LYS CB HB3 sing N N 162 LYS CG CD sing N N 163 LYS CG HG2 sing N N 164 LYS CG HG3 sing N N 165 LYS CD CE sing N N 166 LYS CD HD2 sing N N 167 LYS CD HD3 sing N N 168 LYS CE NZ sing N N 169 LYS CE HE2 sing N N 170 LYS CE HE3 sing N N 171 LYS NZ HZ1 sing N N 172 LYS NZ HZ2 sing N N 173 LYS NZ HZ3 sing N N 174 LYS OXT HXT sing N N 175 MET N CA sing N N 176 MET N H sing N N 177 MET N H2 sing N N 178 MET CA C sing N N 179 MET CA CB sing N N 180 MET CA HA sing N N 181 MET C O doub N N 182 MET C OXT sing N N 183 MET CB CG sing N N 184 MET CB HB2 sing N N 185 MET CB HB3 sing N N 186 MET CG SD sing N N 187 MET CG HG2 sing N N 188 MET CG HG3 sing N N 189 MET SD CE sing N N 190 MET CE HE1 sing N N 191 MET CE HE2 sing N N 192 MET CE HE3 sing N N 193 MET OXT HXT sing N N 194 PHE N CA sing N N 195 PHE N H sing N N 196 PHE N H2 sing N N 197 PHE CA C sing N N 198 PHE CA CB sing N N 199 PHE CA HA sing N N 200 PHE C O doub N N 201 PHE C OXT sing N N 202 PHE CB CG sing N N 203 PHE CB HB2 sing N N 204 PHE CB HB3 sing N N 205 PHE CG CD1 doub Y N 206 PHE CG CD2 sing Y N 207 PHE CD1 CE1 sing Y N 208 PHE CD1 HD1 sing N N 209 PHE CD2 CE2 doub Y N 210 PHE CD2 HD2 sing N N 211 PHE CE1 CZ doub Y N 212 PHE CE1 HE1 sing N N 213 PHE CE2 CZ sing Y N 214 PHE CE2 HE2 sing N N 215 PHE CZ HZ sing N N 216 PHE OXT HXT sing N N 217 PRO N CA sing N N 218 PRO N CD sing N N 219 PRO N H sing N N 220 PRO CA C sing N N 221 PRO CA CB sing N N 222 PRO CA HA sing N N 223 PRO C O doub N N 224 PRO C OXT sing N N 225 PRO CB CG sing N N 226 PRO CB HB2 sing N N 227 PRO CB HB3 sing N N 228 PRO CG CD sing N N 229 PRO CG HG2 sing N N 230 PRO CG HG3 sing N N 231 PRO CD HD2 sing N N 232 PRO CD HD3 sing N N 233 PRO OXT HXT sing N N 234 SER N CA sing N N 235 SER N H sing N N 236 SER N H2 sing N N 237 SER CA C sing N N 238 SER CA CB sing N N 239 SER CA HA sing N N 240 SER C O doub N N 241 SER C OXT sing N N 242 SER CB OG sing N N 243 SER CB HB2 sing N N 244 SER CB HB3 sing N N 245 SER OG HG sing N N 246 SER OXT HXT sing N N 247 THR N CA sing N N 248 THR N H sing N N 249 THR N H2 sing N N 250 THR CA C sing N N 251 THR CA CB sing N N 252 THR CA HA sing N N 253 THR C O doub N N 254 THR C OXT sing N N 255 THR CB OG1 sing N N 256 THR CB CG2 sing N N 257 THR CB HB sing N N 258 THR OG1 HG1 sing N N 259 THR CG2 HG21 sing N N 260 THR CG2 HG22 sing N N 261 THR CG2 HG23 sing N N 262 THR OXT HXT sing N N 263 VAL N CA sing N N 264 VAL N H sing N N 265 VAL N H2 sing N N 266 VAL CA C sing N N 267 VAL CA CB sing N N 268 VAL CA HA sing N N 269 VAL C O doub N N 270 VAL C OXT sing N N 271 VAL CB CG1 sing N N 272 VAL CB CG2 sing N N 273 VAL CB HB sing N N 274 VAL CG1 HG11 sing N N 275 VAL CG1 HG12 sing N N 276 VAL CG1 HG13 sing N N 277 VAL CG2 HG21 sing N N 278 VAL CG2 HG22 sing N N 279 VAL CG2 HG23 sing N N 280 VAL OXT HXT sing N N 281 # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2NDI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_