data_2NRE # _entry.id 2NRE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.377 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2NRE pdb_00002nre 10.2210/pdb2nre/pdb NDB PR0244 ? ? RCSB RCSB040209 ? ? WWPDB D_1000040209 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1DJ0 'apo TRUA' unspecified PDB 2NQP . unspecified PDB 2NR0 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2NRE _pdbx_database_status.recvd_initial_deposition_date 2006-11-01 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hur, S.' 1 'Stroud, R.M.' 2 # _citation.id primary _citation.title 'How U38, 39, and 40 of Many tRNAs Become the Targets for Pseudouridylation by TruA.' _citation.journal_abbrev Mol.Cell _citation.journal_volume 26 _citation.page_first 189 _citation.page_last 203 _citation.year 2007 _citation.journal_id_ASTM MOCEFL _citation.country US _citation.journal_id_ISSN 1097-2765 _citation.journal_id_CSD 2168 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17466622 _citation.pdbx_database_id_DOI 10.1016/j.molcel.2007.02.027 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hur, S.' 1 ? primary 'Stroud, R.M.' 2 ? # _cell.entry_id 2NRE _cell.length_a 80.355 _cell.length_b 80.355 _cell.length_c 205.373 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2NRE _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'leucyl tRNA' 28094.645 1 ? ? ? ? 2 polymer man 'tRNA pseudouridine synthase A' 30441.615 1 5.4.99.12 ? ? ? 3 non-polymer syn 'POTASSIUM ION' 39.098 2 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'tRNA-uridine isomerase I, tRNA pseudouridylate synthase I, PSU-I' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 polyribonucleotide no no ;GCCGAGGUGGUGGAAUUGGUAGACACGCUACCUUGAGGUGGUAGUGCCCAAUAGGGCUUACGGGUUCAAGUCCCGUCCUC GGUACCA ; ;GCCGAGGUGGUGGAAUUGGUAGACACGCUACCUUGAGGUGGUAGUGCCCAAUAGGGCUUACGGGUUCAAGUCCCGUCCUC GGUACCA ; F ? 2 'polypeptide(L)' no no ;MSDQQQPPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKD AAWTLGVNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGEND FTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATA KAEGLYLVAVDYPDRYDLPKPPMGPLFLAD ; ;MSDQQQPPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKD AAWTLGVNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGEND FTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATA KAEGLYLVAVDYPDRYDLPKPPMGPLFLAD ; A ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 G n 1 2 C n 1 3 C n 1 4 G n 1 5 A n 1 6 G n 1 7 G n 1 8 U n 1 9 G n 1 10 G n 1 11 U n 1 12 G n 1 13 G n 1 14 A n 1 15 A n 1 16 U n 1 17 U n 1 18 G n 1 19 G n 1 20 U n 1 21 A n 1 22 G n 1 23 A n 1 24 C n 1 25 A n 1 26 C n 1 27 G n 1 28 C n 1 29 U n 1 30 A n 1 31 C n 1 32 C n 1 33 U n 1 34 U n 1 35 G n 1 36 A n 1 37 G n 1 38 G n 1 39 U n 1 40 G n 1 41 G n 1 42 U n 1 43 A n 1 44 G n 1 45 U n 1 46 G n 1 47 C n 1 48 C n 1 49 C n 1 50 A n 1 51 A n 1 52 U n 1 53 A n 1 54 G n 1 55 G n 1 56 G n 1 57 C n 1 58 U n 1 59 U n 1 60 A n 1 61 C n 1 62 G n 1 63 G n 1 64 G n 1 65 U n 1 66 U n 1 67 C n 1 68 A n 1 69 A n 1 70 G n 1 71 U n 1 72 C n 1 73 C n 1 74 C n 1 75 G n 1 76 U n 1 77 C n 1 78 C n 1 79 U n 1 80 C n 1 81 G n 1 82 G n 1 83 U n 1 84 A n 1 85 C n 1 86 C n 1 87 A n 2 1 MET n 2 2 SER n 2 3 ASP n 2 4 GLN n 2 5 GLN n 2 6 GLN n 2 7 PRO n 2 8 PRO n 2 9 VAL n 2 10 TYR n 2 11 LYS n 2 12 ILE n 2 13 ALA n 2 14 LEU n 2 15 GLY n 2 16 ILE n 2 17 GLU n 2 18 TYR n 2 19 ASP n 2 20 GLY n 2 21 SER n 2 22 LYS n 2 23 TYR n 2 24 TYR n 2 25 GLY n 2 26 TRP n 2 27 GLN n 2 28 ARG n 2 29 GLN n 2 30 ASN n 2 31 GLU n 2 32 VAL n 2 33 ARG n 2 34 SER n 2 35 VAL n 2 36 GLN n 2 37 GLU n 2 38 LYS n 2 39 LEU n 2 40 GLU n 2 41 LYS n 2 42 ALA n 2 43 LEU n 2 44 SER n 2 45 GLN n 2 46 VAL n 2 47 ALA n 2 48 ASN n 2 49 GLU n 2 50 PRO n 2 51 ILE n 2 52 THR n 2 53 VAL n 2 54 PHE n 2 55 CYS n 2 56 ALA n 2 57 GLY n 2 58 ARG n 2 59 THR n 2 60 ASP n 2 61 ALA n 2 62 GLY n 2 63 VAL n 2 64 HIS n 2 65 GLY n 2 66 THR n 2 67 GLY n 2 68 GLN n 2 69 VAL n 2 70 VAL n 2 71 HIS n 2 72 PHE n 2 73 GLU n 2 74 THR n 2 75 THR n 2 76 ALA n 2 77 LEU n 2 78 ARG n 2 79 LYS n 2 80 ASP n 2 81 ALA n 2 82 ALA n 2 83 TRP n 2 84 THR n 2 85 LEU n 2 86 GLY n 2 87 VAL n 2 88 ASN n 2 89 ALA n 2 90 ASN n 2 91 LEU n 2 92 PRO n 2 93 GLY n 2 94 ASP n 2 95 ILE n 2 96 ALA n 2 97 VAL n 2 98 ARG n 2 99 TRP n 2 100 VAL n 2 101 LYS n 2 102 THR n 2 103 VAL n 2 104 PRO n 2 105 ASP n 2 106 ASP n 2 107 PHE n 2 108 HIS n 2 109 ALA n 2 110 ARG n 2 111 PHE n 2 112 SER n 2 113 ALA n 2 114 THR n 2 115 ALA n 2 116 ARG n 2 117 ARG n 2 118 TYR n 2 119 ARG n 2 120 TYR n 2 121 ILE n 2 122 ILE n 2 123 TYR n 2 124 ASN n 2 125 HIS n 2 126 ARG n 2 127 LEU n 2 128 ARG n 2 129 PRO n 2 130 ALA n 2 131 VAL n 2 132 LEU n 2 133 SER n 2 134 LYS n 2 135 GLY n 2 136 VAL n 2 137 THR n 2 138 HIS n 2 139 PHE n 2 140 TYR n 2 141 GLU n 2 142 PRO n 2 143 LEU n 2 144 ASP n 2 145 ALA n 2 146 GLU n 2 147 ARG n 2 148 MET n 2 149 HIS n 2 150 ARG n 2 151 ALA n 2 152 ALA n 2 153 GLN n 2 154 CYS n 2 155 LEU n 2 156 LEU n 2 157 GLY n 2 158 GLU n 2 159 ASN n 2 160 ASP n 2 161 PHE n 2 162 THR n 2 163 SER n 2 164 PHE n 2 165 ARG n 2 166 ALA n 2 167 VAL n 2 168 GLN n 2 169 CYS n 2 170 GLN n 2 171 SER n 2 172 ARG n 2 173 THR n 2 174 PRO n 2 175 TRP n 2 176 ARG n 2 177 ASN n 2 178 VAL n 2 179 MET n 2 180 HIS n 2 181 ILE n 2 182 ASN n 2 183 VAL n 2 184 THR n 2 185 ARG n 2 186 HIS n 2 187 GLY n 2 188 PRO n 2 189 TYR n 2 190 VAL n 2 191 VAL n 2 192 VAL n 2 193 ASP n 2 194 ILE n 2 195 LYS n 2 196 ALA n 2 197 ASN n 2 198 ALA n 2 199 PHE n 2 200 VAL n 2 201 HIS n 2 202 HIS n 2 203 MET n 2 204 VAL n 2 205 ARG n 2 206 ASN n 2 207 ILE n 2 208 VAL n 2 209 GLY n 2 210 SER n 2 211 LEU n 2 212 MET n 2 213 GLU n 2 214 VAL n 2 215 GLY n 2 216 ALA n 2 217 HIS n 2 218 ASN n 2 219 GLN n 2 220 PRO n 2 221 GLU n 2 222 SER n 2 223 TRP n 2 224 ILE n 2 225 ALA n 2 226 GLU n 2 227 LEU n 2 228 LEU n 2 229 ALA n 2 230 ALA n 2 231 LYS n 2 232 ASP n 2 233 ARG n 2 234 THR n 2 235 LEU n 2 236 ALA n 2 237 ALA n 2 238 ALA n 2 239 THR n 2 240 ALA n 2 241 LYS n 2 242 ALA n 2 243 GLU n 2 244 GLY n 2 245 LEU n 2 246 TYR n 2 247 LEU n 2 248 VAL n 2 249 ALA n 2 250 VAL n 2 251 ASP n 2 252 TYR n 2 253 PRO n 2 254 ASP n 2 255 ARG n 2 256 TYR n 2 257 ASP n 2 258 LEU n 2 259 PRO n 2 260 LYS n 2 261 PRO n 2 262 PRO n 2 263 MET n 2 264 GLY n 2 265 PRO n 2 266 LEU n 2 267 PHE n 2 268 LEU n 2 269 ALA n 2 270 ASP n # _entity_src_gen.entity_id 2 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene truA _entity_src_gen.gene_src_species 'Escherichia coli' _entity_src_gen.gene_src_strain K-12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli K12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21/DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'Occurs naturally in E. coli. Synthesized by T7 in vitro transcription' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP TRUA_ECOLI P07649 2 ;PPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLG VNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRA VQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLY LVAVDYPDRYDLPKPPMGPLFLAD ; 7 ? 2 PDB 2NRE 2NRE 1 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2NRE A 7 ? 270 ? P07649 7 ? 270 ? 7 270 2 2 2NRE F 1 ? 87 ? 2NRE 1 ? 76 ? 1 76 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2NRE _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.53 _exptl_crystal.density_percent_sol 65.13 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '20% PEG 3350, 0.2 M K3 Citrate, 5 mM spermine, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # loop_ _exptl_crystal_grow_comp.crystal_id _exptl_crystal_grow_comp.id _exptl_crystal_grow_comp.sol_id _exptl_crystal_grow_comp.name _exptl_crystal_grow_comp.volume _exptl_crystal_grow_comp.conc _exptl_crystal_grow_comp.details 1 1 1 'PEG 3350' ? ? ? 1 2 1 'K3 Citrate' ? ? ? 1 3 1 spermine ? ? ? 1 4 1 H2O ? ? ? 1 5 2 'PEG 3350' ? ? ? 1 6 2 'K3 Citrate' ? ? ? 1 7 2 spermine ? ? ? 1 8 2 H2O ? ? ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2004-01-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double crystal Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0 # _reflns.entry_id 2NRE _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 4.0 _reflns.d_resolution_low 20.0 _reflns.number_all 6998 _reflns.number_obs 6998 _reflns.percent_possible_obs 99.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.172 _reflns.pdbx_netI_over_sigmaI 9.53 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.6 _reflns.R_free_details ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 4.0 _reflns_shell.d_res_low 4.14 _reflns_shell.percent_possible_all 97.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.531 _reflns_shell.meanI_over_sigI_obs 3.38 _reflns_shell.pdbx_redundancy 4.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 664 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2NRE _refine.ls_number_reflns_obs 5809 _refine.ls_number_reflns_all 5809 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 4.00 _refine.ls_percent_reflns_obs 89.24 _refine.ls_R_factor_obs 0.26462 _refine.ls_R_factor_all 0.26462 _refine.ls_R_factor_R_work 0.25946 _refine.ls_R_factor_R_free 0.35735 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.3 _refine.ls_number_reflns_R_free 328 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.842 _refine.correlation_coeff_Fo_to_Fc_free 0.708 _refine.B_iso_mean 63.983 _refine.aniso_B[1][1] 0.71 _refine.aniso_B[2][2] 0.71 _refine.aniso_B[3][3] -1.07 _refine.aniso_B[1][2] 0.36 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS TLS parameter was refined for tRNA (treated as a single TLS group) ; _refine.pdbx_starting_model '1DJ0 and 1EHZ' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 1.132 _refine.overall_SU_ML 0.980 _refine.overall_SU_B 71.759 _refine.ls_redundancy_reflns_obs ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1961 _refine_hist.pdbx_number_atoms_nucleic_acid 1196 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3159 _refine_hist.d_res_high 4.00 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.012 0.021 ? 3444 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.327 2.381 ? 4945 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.097 5.000 ? 257 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 37.650 22.574 ? 101 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 21.798 15.000 ? 328 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 20.920 15.000 ? 19 'X-RAY DIFFRACTION' ? r_chiral_restr 0.078 0.200 ? 593 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.003 0.020 ? 2214 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.308 0.300 ? 1899 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.337 0.500 ? 2221 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.340 0.500 ? 162 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined 0.206 0.500 ? 1 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.262 0.300 ? 32 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.325 0.500 ? 4 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.762 2.000 ? 1292 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.378 3.000 ? 2081 'X-RAY DIFFRACTION' ? r_scbond_it 0.374 2.000 ? 2152 'X-RAY DIFFRACTION' ? r_scangle_it 0.632 3.000 ? 2864 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 4.000 _refine_ls_shell.d_res_low 4.100 _refine_ls_shell.number_reflns_R_work 343 _refine_ls_shell.R_factor_R_work 0.24 _refine_ls_shell.percent_reflns_obs 75.15 _refine_ls_shell.R_factor_R_free 0.263 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2NRE _struct.title 'Crystal structure of pseudoudirinde synthase TruA in complex with leucyl tRNA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2NRE _struct_keywords.pdbx_keywords ISOMERASE/RNA _struct_keywords.text 'pseudouridine synthase, anticodon stem loop, tRNA, multisite specificity, ISOMERASE-RNA COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details 'A molecule of id A forms a dimer with its crystallographic symmetry mate (y,x,-z), and F is the substrate tRNA bound to the enzyme.' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER B 34 ? VAL B 46 ? SER A 34 VAL A 46 1 ? 13 HELX_P HELX_P2 2 GLY B 86 ? ASN B 90 ? GLY A 86 ASN A 90 5 ? 5 HELX_P HELX_P3 3 HIS B 108 ? ALA B 113 ? HIS A 108 ALA A 113 1 ? 6 HELX_P HELX_P4 4 ASP B 144 ? GLN B 153 ? ASP A 144 GLN A 153 1 ? 10 HELX_P HELX_P5 5 ASP B 160 ? PHE B 164 ? ASP A 160 PHE A 164 5 ? 5 HELX_P HELX_P6 6 MET B 203 ? HIS B 217 ? MET A 203 HIS A 217 1 ? 15 HELX_P HELX_P7 7 SER B 222 ? LYS B 231 ? SER A 222 LYS A 231 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A U 17 "O3'" ? ? ? 1_555 D K . K ? ? F U 17 F K 78 1_555 ? ? ? ? ? ? ? 3.208 ? ? metalc2 metalc ? ? A G 18 OP1 ? ? ? 1_555 D K . K ? ? F G 18 F K 78 1_555 ? ? ? ? ? ? ? 3.060 ? ? metalc3 metalc ? ? A C 31 OP1 ? ? ? 1_555 C K . K ? ? F C 30 F K 77 1_555 ? ? ? ? ? ? ? 2.843 ? ? metalc4 metalc ? ? A C 31 OP2 ? ? ? 1_555 C K . K ? ? F C 30 F K 77 1_555 ? ? ? ? ? ? ? 2.584 ? ? metalc5 metalc ? ? A C 31 "O5'" ? ? ? 1_555 C K . K ? ? F C 30 F K 77 1_555 ? ? ? ? ? ? ? 3.249 ? ? hydrog1 hydrog ? ? A G 6 N1 ? ? ? 1_555 A C 78 N3 ? ? F G 6 F C 67 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog2 hydrog ? ? A G 6 N2 ? ? ? 1_555 A C 78 O2 ? ? F G 6 F C 67 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog3 hydrog ? ? A G 6 O6 ? ? ? 1_555 A C 78 N4 ? ? F G 6 F C 67 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog4 hydrog ? ? A G 10 N1 ? ? ? 1_555 A C 26 N3 ? ? F G 10 F C 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog5 hydrog ? ? A G 10 N2 ? ? ? 1_555 A C 26 O2 ? ? F G 10 F C 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog6 hydrog ? ? A G 10 O6 ? ? ? 1_555 A C 26 N4 ? ? F G 10 F C 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog7 hydrog ? ? A U 11 N3 ? ? ? 1_555 A C 26 O2 ? ? F U 11 F C 25 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? ? ? hydrog8 hydrog ? ? A G 12 O6 ? ? ? 1_555 A C 24 N4 ? ? F G 12 F C 23 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? ? hydrog9 hydrog ? ? A A 15 N1 ? ? ? 1_555 A U 59 N3 ? ? F A 15 F U 48 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? ? hydrog10 hydrog ? ? A A 15 N6 ? ? ? 1_555 A U 59 O2 ? ? F A 15 F U 48 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? ? hydrog11 hydrog ? ? A G 18 N1 ? ? ? 1_555 A U 66 O2 ? ? F G 18 F U 55 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? ? hydrog12 hydrog ? ? A G 27 N2 ? ? ? 1_555 A U 45 O2 ? ? F G 26 F U 44 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? ? hydrog13 hydrog ? ? A U 29 N3 ? ? ? 1_555 A A 43 N1 ? ? F U 28 F A 42 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? ? hydrog14 hydrog ? ? A A 30 N1 ? ? ? 1_555 A U 42 N3 ? ? F A 29 F U 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog15 hydrog ? ? A A 30 N6 ? ? ? 1_555 A U 42 O4 ? ? F A 29 F U 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog16 hydrog ? ? A C 31 N3 ? ? ? 1_555 A G 41 N1 ? ? F C 30 F G 40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog17 hydrog ? ? A C 31 N4 ? ? ? 1_555 A G 41 O6 ? ? F C 30 F G 40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog18 hydrog ? ? A C 31 O2 ? ? ? 1_555 A G 41 N2 ? ? F C 30 F G 40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog19 hydrog ? ? A C 32 N3 ? ? ? 1_555 A G 40 N2 ? ? F C 31 F G 39 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? ? hydrog20 hydrog ? ? A A 60 N1 ? ? ? 1_555 A U 76 N3 ? ? F A 49 F U 65 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog21 hydrog ? ? A A 60 N6 ? ? ? 1_555 A U 76 O4 ? ? F A 49 F U 65 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog22 hydrog ? ? A C 61 N3 ? ? ? 1_555 A G 75 N1 ? ? F C 50 F G 64 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog23 hydrog ? ? A C 61 N4 ? ? ? 1_555 A G 75 O6 ? ? F C 50 F G 64 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog24 hydrog ? ? A C 61 O2 ? ? ? 1_555 A G 75 N2 ? ? F C 50 F G 64 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog25 hydrog ? ? A G 62 N1 ? ? ? 1_555 A C 74 N3 ? ? F G 51 F C 63 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? ? hydrog26 hydrog ? ? A G 63 N1 ? ? ? 1_555 A C 73 N3 ? ? F G 52 F C 62 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog27 hydrog ? ? A G 63 N2 ? ? ? 1_555 A C 73 O2 ? ? F G 52 F C 62 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog28 hydrog ? ? A G 63 O6 ? ? ? 1_555 A C 73 N4 ? ? F G 52 F C 62 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog29 hydrog ? ? A G 64 N1 ? ? ? 1_555 A C 72 N3 ? ? F G 53 F C 61 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog30 hydrog ? ? A G 64 N2 ? ? ? 1_555 A C 72 O2 ? ? F G 53 F C 61 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog31 hydrog ? ? A G 64 O6 ? ? ? 1_555 A C 72 N4 ? ? F G 53 F C 61 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog32 hydrog ? ? A U 65 N3 ? ? ? 1_555 A A 69 N7 ? ? F U 54 F A 58 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? hydrog ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 264 _struct_mon_prot_cis.label_asym_id B _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 264 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 265 _struct_mon_prot_cis.pdbx_label_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 265 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.92 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE B 54 ? CYS B 55 ? PHE A 54 CYS A 55 A 2 VAL B 69 ? THR B 74 ? VAL A 69 THR A 74 A 3 TYR B 10 ? TYR B 18 ? TYR A 10 TYR A 18 A 4 ILE B 95 ? THR B 102 ? ILE A 95 THR A 102 B 1 HIS B 64 ? GLY B 65 ? HIS A 64 GLY A 65 B 2 TYR B 246 ? LEU B 247 ? TYR A 246 LEU A 247 C 1 VAL B 183 ? THR B 184 ? VAL A 183 THR A 184 C 2 VAL B 190 ? ILE B 194 ? VAL A 190 ILE A 194 C 3 ALA B 115 ? ILE B 122 ? ALA A 115 ILE A 122 C 4 ALA B 249 ? ASP B 251 ? ALA A 249 ASP A 251 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE B 54 ? N PHE A 54 O HIS B 71 ? O HIS A 71 A 2 3 O THR B 74 ? O THR A 74 N TYR B 10 ? N TYR A 10 A 3 4 N GLU B 17 ? N GLU A 17 O ALA B 96 ? O ALA A 96 B 1 2 N HIS B 64 ? N HIS A 64 O LEU B 247 ? O LEU A 247 C 1 2 N THR B 184 ? N THR A 184 O VAL B 191 ? O VAL A 191 C 2 3 O VAL B 192 ? O VAL A 192 N TYR B 120 ? N TYR A 120 C 3 4 N ALA B 115 ? N ALA A 115 O ASP B 251 ? O ASP A 251 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software F K 77 ? 1 'BINDING SITE FOR RESIDUE K F 77' AC2 Software F K 78 ? 2 'BINDING SITE FOR RESIDUE K F 78' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 C A 31 ? C F 30 . ? 1_555 ? 2 AC2 2 U A 17 ? U F 17 . ? 1_555 ? 3 AC2 2 G A 18 ? G F 18 . ? 1_555 ? # _database_PDB_matrix.entry_id 2NRE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2NRE _atom_sites.fract_transf_matrix[1][1] 0.012445 _atom_sites.fract_transf_matrix[1][2] 0.007185 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014370 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004869 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C K N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 G 1 1 ? ? ? F . n A 1 2 C 2 2 ? ? ? F . n A 1 3 C 3 3 ? ? ? F . n A 1 4 G 4 4 ? ? ? F . n A 1 5 A 5 5 5 A A F . n A 1 6 G 6 6 6 G G F . n A 1 7 G 7 7 7 G G F . n A 1 8 U 8 8 8 U U F . n A 1 9 G 9 9 9 G G F . n A 1 10 G 10 10 10 G G F . n A 1 11 U 11 11 11 U U F . n A 1 12 G 12 12 12 G G F . n A 1 13 G 13 13 13 G G F . n A 1 14 A 14 14 14 A A F . n A 1 15 A 15 15 15 A A F . n A 1 16 U 16 16 16 U U F . n A 1 17 U 17 17 17 U U F . n A 1 18 G 18 18 18 G G F . n A 1 19 G 19 19 19 G G F . n A 1 20 U 20 20 20 U U F . n A 1 21 A 21 20 20 A A F A n A 1 22 G 22 21 21 G G F . n A 1 23 A 23 22 22 A A F . n A 1 24 C 24 23 23 C C F . n A 1 25 A 25 24 24 A A F . n A 1 26 C 26 25 25 C C F . n A 1 27 G 27 26 26 G G F . n A 1 28 C 28 27 27 C C F . n A 1 29 U 29 28 28 U U F . n A 1 30 A 30 29 29 A A F . n A 1 31 C 31 30 30 C C F . n A 1 32 C 32 31 31 C C F . n A 1 33 U 33 32 ? ? ? F . n A 1 34 U 34 33 ? ? ? F . n A 1 35 G 35 34 ? ? ? F . n A 1 36 A 36 35 ? ? ? F . n A 1 37 G 37 36 ? ? ? F . n A 1 38 G 38 37 ? ? ? F . n A 1 39 U 39 38 ? ? ? F . n A 1 40 G 40 39 39 G G F . n A 1 41 G 41 40 40 G G F . n A 1 42 U 42 41 41 U U F . n A 1 43 A 43 42 42 A A F . n A 1 44 G 44 43 43 G G F . n A 1 45 U 45 44 44 U U F . n A 1 46 G 46 44 ? ? ? F A n A 1 47 C 47 44 ? ? ? F B n A 1 48 C 48 44 ? ? ? F C n A 1 49 C 49 44 ? ? ? F D n A 1 50 A 50 44 ? ? ? F E n A 1 51 A 51 44 ? ? ? F F n A 1 52 U 52 44 ? ? ? F G n A 1 53 A 53 44 ? ? ? F H n A 1 54 G 54 44 ? ? ? F I n A 1 55 G 55 44 ? ? ? F J n A 1 56 G 56 44 ? ? ? F K n A 1 57 C 57 44 ? ? ? F L n A 1 58 U 58 44 ? ? ? F M n A 1 59 U 59 48 48 U U F . n A 1 60 A 60 49 49 A A F . n A 1 61 C 61 50 50 C C F . n A 1 62 G 62 51 51 G G F . n A 1 63 G 63 52 52 G G F . n A 1 64 G 64 53 53 G G F . n A 1 65 U 65 54 54 U U F . n A 1 66 U 66 55 55 U U F . n A 1 67 C 67 56 56 C C F . n A 1 68 A 68 57 57 A A F . n A 1 69 A 69 58 58 A A F . n A 1 70 G 70 59 59 G G F . n A 1 71 U 71 60 60 U U F . n A 1 72 C 72 61 61 C C F . n A 1 73 C 73 62 62 C C F . n A 1 74 C 74 63 63 C C F . n A 1 75 G 75 64 64 G G F . n A 1 76 U 76 65 65 U U F . n A 1 77 C 77 66 66 C C F . n A 1 78 C 78 67 67 C C F . n A 1 79 U 79 68 68 U U F . n A 1 80 C 80 69 69 C C F . n A 1 81 G 81 70 ? ? ? F . n A 1 82 G 82 71 ? ? ? F . n A 1 83 U 83 72 ? ? ? F . n A 1 84 A 84 73 ? ? ? F . n A 1 85 C 85 74 ? ? ? F . n A 1 86 C 86 75 ? ? ? F . n A 1 87 A 87 76 ? ? ? F . n B 2 1 MET 1 1 ? ? ? A . n B 2 2 SER 2 2 ? ? ? A . n B 2 3 ASP 3 3 ? ? ? A . n B 2 4 GLN 4 4 ? ? ? A . n B 2 5 GLN 5 5 ? ? ? A . n B 2 6 GLN 6 6 ? ? ? A . n B 2 7 PRO 7 7 7 PRO PRO A . n B 2 8 PRO 8 8 8 PRO PRO A . n B 2 9 VAL 9 9 9 VAL VAL A . n B 2 10 TYR 10 10 10 TYR TYR A . n B 2 11 LYS 11 11 11 LYS LYS A . n B 2 12 ILE 12 12 12 ILE ILE A . n B 2 13 ALA 13 13 13 ALA ALA A . n B 2 14 LEU 14 14 14 LEU LEU A . n B 2 15 GLY 15 15 15 GLY GLY A . n B 2 16 ILE 16 16 16 ILE ILE A . n B 2 17 GLU 17 17 17 GLU GLU A . n B 2 18 TYR 18 18 18 TYR TYR A . n B 2 19 ASP 19 19 19 ASP ASP A . n B 2 20 GLY 20 20 20 GLY GLY A . n B 2 21 SER 21 21 21 SER SER A . n B 2 22 LYS 22 22 22 LYS LYS A . n B 2 23 TYR 23 23 23 TYR TYR A . n B 2 24 TYR 24 24 24 TYR TYR A . n B 2 25 GLY 25 25 25 GLY GLY A . n B 2 26 TRP 26 26 26 TRP TRP A . n B 2 27 GLN 27 27 27 GLN GLN A . n B 2 28 ARG 28 28 28 ARG ARG A . n B 2 29 GLN 29 29 29 GLN GLN A . n B 2 30 ASN 30 30 30 ASN ASN A . n B 2 31 GLU 31 31 31 GLU GLU A . n B 2 32 VAL 32 32 32 VAL VAL A . n B 2 33 ARG 33 33 33 ARG ARG A . n B 2 34 SER 34 34 34 SER SER A . n B 2 35 VAL 35 35 35 VAL VAL A . n B 2 36 GLN 36 36 36 GLN GLN A . n B 2 37 GLU 37 37 37 GLU GLU A . n B 2 38 LYS 38 38 38 LYS LYS A . n B 2 39 LEU 39 39 39 LEU LEU A . n B 2 40 GLU 40 40 40 GLU GLU A . n B 2 41 LYS 41 41 41 LYS LYS A . n B 2 42 ALA 42 42 42 ALA ALA A . n B 2 43 LEU 43 43 43 LEU LEU A . n B 2 44 SER 44 44 44 SER SER A . n B 2 45 GLN 45 45 45 GLN GLN A . n B 2 46 VAL 46 46 46 VAL VAL A . n B 2 47 ALA 47 47 47 ALA ALA A . n B 2 48 ASN 48 48 48 ASN ASN A . n B 2 49 GLU 49 49 49 GLU GLU A . n B 2 50 PRO 50 50 50 PRO PRO A . n B 2 51 ILE 51 51 51 ILE ILE A . n B 2 52 THR 52 52 52 THR THR A . n B 2 53 VAL 53 53 53 VAL VAL A . n B 2 54 PHE 54 54 54 PHE PHE A . n B 2 55 CYS 55 55 55 CYS CYS A . n B 2 56 ALA 56 56 56 ALA ALA A . n B 2 57 GLY 57 57 57 GLY GLY A . n B 2 58 ARG 58 58 58 ARG ARG A . n B 2 59 THR 59 59 59 THR THR A . n B 2 60 ASP 60 60 60 ASP ASP A . n B 2 61 ALA 61 61 61 ALA ALA A . n B 2 62 GLY 62 62 62 GLY GLY A . n B 2 63 VAL 63 63 63 VAL VAL A . n B 2 64 HIS 64 64 64 HIS HIS A . n B 2 65 GLY 65 65 65 GLY GLY A . n B 2 66 THR 66 66 66 THR THR A . n B 2 67 GLY 67 67 67 GLY GLY A . n B 2 68 GLN 68 68 68 GLN GLN A . n B 2 69 VAL 69 69 69 VAL VAL A . n B 2 70 VAL 70 70 70 VAL VAL A . n B 2 71 HIS 71 71 71 HIS HIS A . n B 2 72 PHE 72 72 72 PHE PHE A . n B 2 73 GLU 73 73 73 GLU GLU A . n B 2 74 THR 74 74 74 THR THR A . n B 2 75 THR 75 75 75 THR THR A . n B 2 76 ALA 76 76 76 ALA ALA A . n B 2 77 LEU 77 77 77 LEU LEU A . n B 2 78 ARG 78 78 78 ARG ARG A . n B 2 79 LYS 79 79 79 LYS LYS A . n B 2 80 ASP 80 80 80 ASP ASP A . n B 2 81 ALA 81 81 81 ALA ALA A . n B 2 82 ALA 82 82 82 ALA ALA A . n B 2 83 TRP 83 83 83 TRP TRP A . n B 2 84 THR 84 84 84 THR THR A . n B 2 85 LEU 85 85 85 LEU LEU A . n B 2 86 GLY 86 86 86 GLY GLY A . n B 2 87 VAL 87 87 87 VAL VAL A . n B 2 88 ASN 88 88 88 ASN ASN A . n B 2 89 ALA 89 89 89 ALA ALA A . n B 2 90 ASN 90 90 90 ASN ASN A . n B 2 91 LEU 91 91 91 LEU LEU A . n B 2 92 PRO 92 92 92 PRO PRO A . n B 2 93 GLY 93 93 93 GLY GLY A . n B 2 94 ASP 94 94 94 ASP ASP A . n B 2 95 ILE 95 95 95 ILE ILE A . n B 2 96 ALA 96 96 96 ALA ALA A . n B 2 97 VAL 97 97 97 VAL VAL A . n B 2 98 ARG 98 98 98 ARG ARG A . n B 2 99 TRP 99 99 99 TRP TRP A . n B 2 100 VAL 100 100 100 VAL VAL A . n B 2 101 LYS 101 101 101 LYS LYS A . n B 2 102 THR 102 102 102 THR THR A . n B 2 103 VAL 103 103 103 VAL VAL A . n B 2 104 PRO 104 104 104 PRO PRO A . n B 2 105 ASP 105 105 105 ASP ASP A . n B 2 106 ASP 106 106 106 ASP ASP A . n B 2 107 PHE 107 107 107 PHE PHE A . n B 2 108 HIS 108 108 108 HIS HIS A . n B 2 109 ALA 109 109 109 ALA ALA A . n B 2 110 ARG 110 110 110 ARG ARG A . n B 2 111 PHE 111 111 111 PHE PHE A . n B 2 112 SER 112 112 112 SER SER A . n B 2 113 ALA 113 113 113 ALA ALA A . n B 2 114 THR 114 114 114 THR THR A . n B 2 115 ALA 115 115 115 ALA ALA A . n B 2 116 ARG 116 116 116 ARG ARG A . n B 2 117 ARG 117 117 117 ARG ARG A . n B 2 118 TYR 118 118 118 TYR TYR A . n B 2 119 ARG 119 119 119 ARG ARG A . n B 2 120 TYR 120 120 120 TYR TYR A . n B 2 121 ILE 121 121 121 ILE ILE A . n B 2 122 ILE 122 122 122 ILE ILE A . n B 2 123 TYR 123 123 123 TYR TYR A . n B 2 124 ASN 124 124 124 ASN ASN A . n B 2 125 HIS 125 125 125 HIS HIS A . n B 2 126 ARG 126 126 126 ARG ARG A . n B 2 127 LEU 127 127 127 LEU LEU A . n B 2 128 ARG 128 128 128 ARG ARG A . n B 2 129 PRO 129 129 129 PRO PRO A . n B 2 130 ALA 130 130 130 ALA ALA A . n B 2 131 VAL 131 131 131 VAL VAL A . n B 2 132 LEU 132 132 132 LEU LEU A . n B 2 133 SER 133 133 133 SER SER A . n B 2 134 LYS 134 134 134 LYS LYS A . n B 2 135 GLY 135 135 135 GLY GLY A . n B 2 136 VAL 136 136 136 VAL VAL A . n B 2 137 THR 137 137 137 THR THR A . n B 2 138 HIS 138 138 138 HIS HIS A . n B 2 139 PHE 139 139 139 PHE PHE A . n B 2 140 TYR 140 140 140 TYR TYR A . n B 2 141 GLU 141 141 141 GLU GLU A . n B 2 142 PRO 142 142 142 PRO PRO A . n B 2 143 LEU 143 143 143 LEU LEU A . n B 2 144 ASP 144 144 144 ASP ASP A . n B 2 145 ALA 145 145 145 ALA ALA A . n B 2 146 GLU 146 146 146 GLU GLU A . n B 2 147 ARG 147 147 147 ARG ARG A . n B 2 148 MET 148 148 148 MET MET A . n B 2 149 HIS 149 149 149 HIS HIS A . n B 2 150 ARG 150 150 150 ARG ARG A . n B 2 151 ALA 151 151 151 ALA ALA A . n B 2 152 ALA 152 152 152 ALA ALA A . n B 2 153 GLN 153 153 153 GLN GLN A . n B 2 154 CYS 154 154 154 CYS CYS A . n B 2 155 LEU 155 155 155 LEU LEU A . n B 2 156 LEU 156 156 156 LEU LEU A . n B 2 157 GLY 157 157 157 GLY GLY A . n B 2 158 GLU 158 158 158 GLU GLU A . n B 2 159 ASN 159 159 159 ASN ASN A . n B 2 160 ASP 160 160 160 ASP ASP A . n B 2 161 PHE 161 161 161 PHE PHE A . n B 2 162 THR 162 162 162 THR THR A . n B 2 163 SER 163 163 163 SER SER A . n B 2 164 PHE 164 164 164 PHE PHE A . n B 2 165 ARG 165 165 165 ARG ARG A . n B 2 166 ALA 166 166 166 ALA ALA A . n B 2 167 VAL 167 167 167 VAL VAL A . n B 2 168 GLN 168 168 ? ? ? A . n B 2 169 CYS 169 169 ? ? ? A . n B 2 170 GLN 170 170 ? ? ? A . n B 2 171 SER 171 171 ? ? ? A . n B 2 172 ARG 172 172 ? ? ? A . n B 2 173 THR 173 173 173 THR THR A . n B 2 174 PRO 174 174 174 PRO PRO A . n B 2 175 TRP 175 175 175 TRP TRP A . n B 2 176 ARG 176 176 176 ARG ARG A . n B 2 177 ASN 177 177 177 ASN ASN A . n B 2 178 VAL 178 178 178 VAL VAL A . n B 2 179 MET 179 179 179 MET MET A . n B 2 180 HIS 180 180 180 HIS HIS A . n B 2 181 ILE 181 181 181 ILE ILE A . n B 2 182 ASN 182 182 182 ASN ASN A . n B 2 183 VAL 183 183 183 VAL VAL A . n B 2 184 THR 184 184 184 THR THR A . n B 2 185 ARG 185 185 185 ARG ARG A . n B 2 186 HIS 186 186 186 HIS HIS A . n B 2 187 GLY 187 187 187 GLY GLY A . n B 2 188 PRO 188 188 188 PRO PRO A . n B 2 189 TYR 189 189 189 TYR TYR A . n B 2 190 VAL 190 190 190 VAL VAL A . n B 2 191 VAL 191 191 191 VAL VAL A . n B 2 192 VAL 192 192 192 VAL VAL A . n B 2 193 ASP 193 193 193 ASP ASP A . n B 2 194 ILE 194 194 194 ILE ILE A . n B 2 195 LYS 195 195 195 LYS LYS A . n B 2 196 ALA 196 196 196 ALA ALA A . n B 2 197 ASN 197 197 197 ASN ASN A . n B 2 198 ALA 198 198 198 ALA ALA A . n B 2 199 PHE 199 199 199 PHE PHE A . n B 2 200 VAL 200 200 200 VAL VAL A . n B 2 201 HIS 201 201 201 HIS HIS A . n B 2 202 HIS 202 202 202 HIS HIS A . n B 2 203 MET 203 203 203 MET MET A . n B 2 204 VAL 204 204 204 VAL VAL A . n B 2 205 ARG 205 205 205 ARG ARG A . n B 2 206 ASN 206 206 206 ASN ASN A . n B 2 207 ILE 207 207 207 ILE ILE A . n B 2 208 VAL 208 208 208 VAL VAL A . n B 2 209 GLY 209 209 209 GLY GLY A . n B 2 210 SER 210 210 210 SER SER A . n B 2 211 LEU 211 211 211 LEU LEU A . n B 2 212 MET 212 212 212 MET MET A . n B 2 213 GLU 213 213 213 GLU GLU A . n B 2 214 VAL 214 214 214 VAL VAL A . n B 2 215 GLY 215 215 215 GLY GLY A . n B 2 216 ALA 216 216 216 ALA ALA A . n B 2 217 HIS 217 217 217 HIS HIS A . n B 2 218 ASN 218 218 218 ASN ASN A . n B 2 219 GLN 219 219 219 GLN GLN A . n B 2 220 PRO 220 220 220 PRO PRO A . n B 2 221 GLU 221 221 221 GLU GLU A . n B 2 222 SER 222 222 222 SER SER A . n B 2 223 TRP 223 223 223 TRP TRP A . n B 2 224 ILE 224 224 224 ILE ILE A . n B 2 225 ALA 225 225 225 ALA ALA A . n B 2 226 GLU 226 226 226 GLU GLU A . n B 2 227 LEU 227 227 227 LEU LEU A . n B 2 228 LEU 228 228 228 LEU LEU A . n B 2 229 ALA 229 229 229 ALA ALA A . n B 2 230 ALA 230 230 230 ALA ALA A . n B 2 231 LYS 231 231 231 LYS LYS A . n B 2 232 ASP 232 232 232 ASP ASP A . n B 2 233 ARG 233 233 233 ARG ARG A . n B 2 234 THR 234 234 234 THR THR A . n B 2 235 LEU 235 235 235 LEU LEU A . n B 2 236 ALA 236 236 236 ALA ALA A . n B 2 237 ALA 237 237 237 ALA ALA A . n B 2 238 ALA 238 238 238 ALA ALA A . n B 2 239 THR 239 239 239 THR THR A . n B 2 240 ALA 240 240 240 ALA ALA A . n B 2 241 LYS 241 241 241 LYS LYS A . n B 2 242 ALA 242 242 242 ALA ALA A . n B 2 243 GLU 243 243 243 GLU GLU A . n B 2 244 GLY 244 244 244 GLY GLY A . n B 2 245 LEU 245 245 245 LEU LEU A . n B 2 246 TYR 246 246 246 TYR TYR A . n B 2 247 LEU 247 247 247 LEU LEU A . n B 2 248 VAL 248 248 248 VAL VAL A . n B 2 249 ALA 249 249 249 ALA ALA A . n B 2 250 VAL 250 250 250 VAL VAL A . n B 2 251 ASP 251 251 251 ASP ASP A . n B 2 252 TYR 252 252 252 TYR TYR A . n B 2 253 PRO 253 253 253 PRO PRO A . n B 2 254 ASP 254 254 254 ASP ASP A . n B 2 255 ARG 255 255 255 ARG ARG A . n B 2 256 TYR 256 256 256 TYR TYR A . n B 2 257 ASP 257 257 257 ASP ASP A . n B 2 258 LEU 258 258 258 LEU LEU A . n B 2 259 PRO 259 259 259 PRO PRO A . n B 2 260 LYS 260 260 260 LYS LYS A . n B 2 261 PRO 261 261 261 PRO PRO A . n B 2 262 PRO 262 262 262 PRO PRO A . n B 2 263 MET 263 263 263 MET MET A . n B 2 264 GLY 264 264 264 GLY GLY A . n B 2 265 PRO 265 265 265 PRO PRO A . n B 2 266 LEU 266 266 266 LEU LEU A . n B 2 267 PHE 267 267 267 PHE PHE A . n B 2 268 LEU 268 268 268 LEU LEU A . n B 2 269 ALA 269 269 269 ALA ALA A . n B 2 270 ASP 270 270 270 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 K 1 77 1 K K F . D 3 K 1 78 2 K K F . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 68.4576666667 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 "O3'" ? A U 17 ? F U 17 ? 1_555 K ? D K . ? F K 78 ? 1_555 OP1 ? A G 18 ? F G 18 ? 1_555 46.5 ? 2 OP1 ? A C 31 ? F C 30 ? 1_555 K ? C K . ? F K 77 ? 1_555 OP2 ? A C 31 ? F C 30 ? 1_555 56.1 ? 3 OP1 ? A C 31 ? F C 30 ? 1_555 K ? C K . ? F K 77 ? 1_555 "O5'" ? A C 31 ? F C 30 ? 1_555 48.1 ? 4 OP2 ? A C 31 ? F C 30 ? 1_555 K ? C K . ? F K 77 ? 1_555 "O5'" ? A C 31 ? F C 30 ? 1_555 49.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-05-15 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_initial_refinement_model 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -13.5580 _pdbx_refine_tls.origin_y -28.6230 _pdbx_refine_tls.origin_z 25.5500 _pdbx_refine_tls.T[1][1] 0.8532 _pdbx_refine_tls.T[2][2] 0.2332 _pdbx_refine_tls.T[3][3] 0.2665 _pdbx_refine_tls.T[1][2] -0.5022 _pdbx_refine_tls.T[1][3] 0.0326 _pdbx_refine_tls.T[2][3] 0.0264 _pdbx_refine_tls.L[1][1] 0.7861 _pdbx_refine_tls.L[2][2] 5.1351 _pdbx_refine_tls.L[3][3] 2.1378 _pdbx_refine_tls.L[1][2] 1.9651 _pdbx_refine_tls.L[1][3] -0.9894 _pdbx_refine_tls.L[2][3] -2.0272 _pdbx_refine_tls.S[1][1] -0.2476 _pdbx_refine_tls.S[1][2] 0.5527 _pdbx_refine_tls.S[1][3] -0.2204 _pdbx_refine_tls.S[2][1] -0.5464 _pdbx_refine_tls.S[2][2] 0.4767 _pdbx_refine_tls.S[2][3] 0.2514 _pdbx_refine_tls.S[3][1] 0.0983 _pdbx_refine_tls.S[3][2] -0.1231 _pdbx_refine_tls.S[3][3] -0.2291 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id F _pdbx_refine_tls_group.beg_auth_seq_id 5 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 5 _pdbx_refine_tls_group.end_auth_asym_id F _pdbx_refine_tls_group.end_auth_seq_id 69 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 80 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 ADSC 'data collection' QUANTUM ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 PHASER phasing . ? 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 "C3'" F C 25 ? ? "O3'" F C 25 ? ? P F G 26 ? ? 102.03 119.70 -17.67 1.20 Y 2 1 "O3'" F C 25 ? ? P F G 26 ? ? "O5'" F G 26 ? ? 118.25 104.00 14.25 1.90 Y 3 1 OP1 F G 26 ? ? P F G 26 ? ? OP2 F G 26 ? ? 106.81 119.60 -12.79 1.50 N 4 1 P F G 26 ? ? "O5'" F G 26 ? ? "C5'" F G 26 ? ? 107.64 120.90 -13.26 1.60 N 5 1 OP1 F G 39 ? ? P F G 39 ? ? OP2 F G 39 ? ? 108.98 119.60 -10.62 1.50 N 6 1 "C3'" F G 39 ? ? "O3'" F G 39 ? ? P F G 40 ? ? 126.90 119.70 7.20 1.20 Y 7 1 OP1 F U 48 ? ? P F U 48 ? ? OP2 F U 48 ? ? 109.50 119.60 -10.10 1.50 N 8 1 "C3'" F A 58 ? ? "O3'" F A 58 ? ? P F G 59 ? ? 130.20 119.70 10.50 1.20 Y 9 1 C A GLU 141 ? ? N A PRO 142 ? ? CA A PRO 142 ? ? 129.08 119.30 9.78 1.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 21 ? ? 78.76 -39.89 2 1 ARG A 28 ? ? -70.91 -131.04 3 1 GLN A 29 ? ? 103.50 79.00 4 1 ASN A 30 ? ? -0.13 106.22 5 1 GLU A 31 ? ? 157.41 -73.43 6 1 VAL A 32 ? ? -103.39 -113.25 7 1 VAL A 35 ? ? -57.18 -75.44 8 1 LYS A 41 ? ? -49.44 -79.45 9 1 VAL A 46 ? ? -90.97 37.34 10 1 ALA A 47 ? ? -172.29 0.48 11 1 ASN A 48 ? ? 48.04 -3.91 12 1 PRO A 50 ? ? -28.86 113.58 13 1 ARG A 58 ? ? -61.03 65.39 14 1 ASP A 60 ? ? -88.92 -150.60 15 1 THR A 66 ? ? -143.90 10.93 16 1 ALA A 81 ? ? -162.29 -54.14 17 1 THR A 84 ? ? -88.21 -88.43 18 1 VAL A 87 ? ? -25.57 -82.57 19 1 ASN A 88 ? ? -57.91 -3.39 20 1 THR A 102 ? ? -65.75 97.06 21 1 ASP A 105 ? ? -37.39 -29.50 22 1 ALA A 115 ? ? -171.07 148.54 23 1 ASN A 124 ? ? -159.83 1.60 24 1 ARG A 126 ? ? 82.18 -5.12 25 1 ARG A 128 ? ? -12.49 131.03 26 1 VAL A 131 ? ? -67.20 67.49 27 1 LEU A 132 ? ? 55.09 115.04 28 1 SER A 133 ? ? -55.81 -114.44 29 1 LYS A 134 ? ? -18.77 101.39 30 1 VAL A 136 ? ? -165.12 -41.31 31 1 THR A 137 ? ? 56.98 125.82 32 1 TYR A 140 ? ? -82.18 -101.65 33 1 ARG A 147 ? ? -73.98 -72.15 34 1 MET A 148 ? ? -16.94 -71.83 35 1 GLN A 153 ? ? -48.86 67.59 36 1 CYS A 154 ? ? -174.44 -5.75 37 1 GLU A 158 ? ? 156.21 -5.98 38 1 ASN A 159 ? ? -41.19 -178.56 39 1 ASN A 182 ? ? 168.99 114.31 40 1 ARG A 185 ? ? -116.30 74.41 41 1 HIS A 201 ? ? -32.99 127.53 42 1 HIS A 202 ? ? 49.35 -74.94 43 1 MET A 203 ? ? 55.09 -103.86 44 1 VAL A 204 ? ? 2.94 -71.15 45 1 SER A 210 ? ? -68.22 10.18 46 1 HIS A 217 ? ? 77.10 -130.64 47 1 ASN A 218 ? ? 65.68 -24.05 48 1 TRP A 223 ? ? -39.54 -23.73 49 1 THR A 234 ? ? -53.03 26.52 50 1 LEU A 235 ? ? -121.36 -51.93 51 1 ALA A 236 ? ? -69.60 -177.49 52 1 LYS A 241 ? ? 0.09 -120.14 53 1 ALA A 242 ? ? -171.93 -53.65 54 1 GLU A 243 ? ? -64.13 42.39 55 1 ALA A 249 ? ? 170.17 145.81 56 1 ASP A 257 ? ? 55.59 84.58 57 1 PRO A 261 ? ? -101.17 -167.88 58 1 LEU A 266 ? ? -137.22 -135.44 59 1 LEU A 268 ? ? -23.81 98.73 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 11 ? CG ? B LYS 11 CG 2 1 Y 1 A LYS 11 ? CD ? B LYS 11 CD 3 1 Y 1 A LYS 11 ? CE ? B LYS 11 CE 4 1 Y 1 A LYS 11 ? NZ ? B LYS 11 NZ 5 1 Y 1 A GLU 17 ? CG ? B GLU 17 CG 6 1 Y 1 A GLU 17 ? CD ? B GLU 17 CD 7 1 Y 1 A GLU 17 ? OE1 ? B GLU 17 OE1 8 1 Y 1 A GLU 17 ? OE2 ? B GLU 17 OE2 9 1 Y 1 A LYS 22 ? CG ? B LYS 22 CG 10 1 Y 1 A LYS 22 ? CD ? B LYS 22 CD 11 1 Y 1 A LYS 22 ? CE ? B LYS 22 CE 12 1 Y 1 A LYS 22 ? NZ ? B LYS 22 NZ 13 1 Y 1 A GLN 27 ? CG ? B GLN 27 CG 14 1 Y 1 A GLN 27 ? CD ? B GLN 27 CD 15 1 Y 1 A GLN 27 ? OE1 ? B GLN 27 OE1 16 1 Y 1 A GLN 27 ? NE2 ? B GLN 27 NE2 17 1 Y 1 A GLN 29 ? CB ? B GLN 29 CB 18 1 Y 1 A GLN 29 ? CG ? B GLN 29 CG 19 1 Y 1 A GLN 29 ? CD ? B GLN 29 CD 20 1 Y 1 A GLN 29 ? OE1 ? B GLN 29 OE1 21 1 Y 1 A GLN 29 ? NE2 ? B GLN 29 NE2 22 1 Y 1 A ASN 30 ? CB ? B ASN 30 CB 23 1 Y 1 A ASN 30 ? CG ? B ASN 30 CG 24 1 Y 1 A ASN 30 ? OD1 ? B ASN 30 OD1 25 1 Y 1 A ASN 30 ? ND2 ? B ASN 30 ND2 26 1 Y 1 A GLU 31 ? CD ? B GLU 31 CD 27 1 Y 1 A GLU 31 ? OE1 ? B GLU 31 OE1 28 1 Y 1 A GLU 31 ? OE2 ? B GLU 31 OE2 29 1 Y 1 A GLU 37 ? CG ? B GLU 37 CG 30 1 Y 1 A GLU 37 ? CD ? B GLU 37 CD 31 1 Y 1 A GLU 37 ? OE1 ? B GLU 37 OE1 32 1 Y 1 A GLU 37 ? OE2 ? B GLU 37 OE2 33 1 Y 1 A LYS 38 ? CG ? B LYS 38 CG 34 1 Y 1 A LYS 38 ? CD ? B LYS 38 CD 35 1 Y 1 A LYS 38 ? CE ? B LYS 38 CE 36 1 Y 1 A LYS 38 ? NZ ? B LYS 38 NZ 37 1 Y 1 A GLN 45 ? CD ? B GLN 45 CD 38 1 Y 1 A GLN 45 ? OE1 ? B GLN 45 OE1 39 1 Y 1 A GLN 45 ? NE2 ? B GLN 45 NE2 40 1 Y 1 A GLU 73 ? CB ? B GLU 73 CB 41 1 Y 1 A GLU 73 ? CG ? B GLU 73 CG 42 1 Y 1 A GLU 73 ? CD ? B GLU 73 CD 43 1 Y 1 A GLU 73 ? OE1 ? B GLU 73 OE1 44 1 Y 1 A GLU 73 ? OE2 ? B GLU 73 OE2 45 1 Y 1 A LEU 77 ? CD1 ? B LEU 77 CD1 46 1 Y 1 A LEU 77 ? CD2 ? B LEU 77 CD2 47 1 Y 1 A VAL 131 ? CB ? B VAL 131 CB 48 1 Y 1 A VAL 131 ? CG1 ? B VAL 131 CG1 49 1 Y 1 A VAL 131 ? CG2 ? B VAL 131 CG2 50 1 Y 1 A LEU 132 ? CG ? B LEU 132 CG 51 1 Y 1 A LEU 132 ? CD1 ? B LEU 132 CD1 52 1 Y 1 A LEU 132 ? CD2 ? B LEU 132 CD2 53 1 Y 1 A ASP 144 ? CG ? B ASP 144 CG 54 1 Y 1 A ASP 144 ? OD1 ? B ASP 144 OD1 55 1 Y 1 A ASP 144 ? OD2 ? B ASP 144 OD2 56 1 Y 1 A GLU 146 ? CB ? B GLU 146 CB 57 1 Y 1 A GLU 146 ? CG ? B GLU 146 CG 58 1 Y 1 A GLU 146 ? CD ? B GLU 146 CD 59 1 Y 1 A GLU 146 ? OE1 ? B GLU 146 OE1 60 1 Y 1 A GLU 146 ? OE2 ? B GLU 146 OE2 61 1 Y 1 A ASP 160 ? CB ? B ASP 160 CB 62 1 Y 1 A ASP 160 ? CG ? B ASP 160 CG 63 1 Y 1 A ASP 160 ? OD1 ? B ASP 160 OD1 64 1 Y 1 A ASP 160 ? OD2 ? B ASP 160 OD2 65 1 Y 1 A TRP 175 ? CG ? B TRP 175 CG 66 1 Y 1 A TRP 175 ? CD1 ? B TRP 175 CD1 67 1 Y 1 A TRP 175 ? CD2 ? B TRP 175 CD2 68 1 Y 1 A TRP 175 ? NE1 ? B TRP 175 NE1 69 1 Y 1 A TRP 175 ? CE2 ? B TRP 175 CE2 70 1 Y 1 A TRP 175 ? CE3 ? B TRP 175 CE3 71 1 Y 1 A TRP 175 ? CZ2 ? B TRP 175 CZ2 72 1 Y 1 A TRP 175 ? CZ3 ? B TRP 175 CZ3 73 1 Y 1 A TRP 175 ? CH2 ? B TRP 175 CH2 74 1 Y 1 A ARG 176 ? CB ? B ARG 176 CB 75 1 Y 1 A ARG 176 ? CG ? B ARG 176 CG 76 1 Y 1 A ARG 176 ? CD ? B ARG 176 CD 77 1 Y 1 A ARG 176 ? NE ? B ARG 176 NE 78 1 Y 1 A ARG 176 ? CZ ? B ARG 176 CZ 79 1 Y 1 A ARG 176 ? NH1 ? B ARG 176 NH1 80 1 Y 1 A ARG 176 ? NH2 ? B ARG 176 NH2 81 1 Y 1 A LYS 195 ? CB ? B LYS 195 CB 82 1 Y 1 A LYS 195 ? CG ? B LYS 195 CG 83 1 Y 1 A LYS 195 ? CD ? B LYS 195 CD 84 1 Y 1 A LYS 195 ? CE ? B LYS 195 CE 85 1 Y 1 A LYS 195 ? NZ ? B LYS 195 NZ 86 1 Y 1 A LYS 231 ? CD ? B LYS 231 CD 87 1 Y 1 A LYS 231 ? CE ? B LYS 231 CE 88 1 Y 1 A LYS 231 ? NZ ? B LYS 231 NZ 89 1 Y 1 A ARG 255 ? CG ? B ARG 255 CG 90 1 Y 1 A ARG 255 ? CD ? B ARG 255 CD 91 1 Y 1 A ARG 255 ? NE ? B ARG 255 NE 92 1 Y 1 A ARG 255 ? CZ ? B ARG 255 CZ 93 1 Y 1 A ARG 255 ? NH1 ? B ARG 255 NH1 94 1 Y 1 A ARG 255 ? NH2 ? B ARG 255 NH2 95 1 Y 1 A ASP 270 ? O ? B ASP 270 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 F G 1 ? A G 1 2 1 Y 1 F C 2 ? A C 2 3 1 Y 1 F C 3 ? A C 3 4 1 Y 1 F G 4 ? A G 4 5 1 Y 1 F U 32 ? A U 33 6 1 Y 1 F U 33 ? A U 34 7 1 Y 1 F G 34 ? A G 35 8 1 Y 1 F A 35 ? A A 36 9 1 Y 1 F G 36 ? A G 37 10 1 Y 1 F G 37 ? A G 38 11 1 Y 1 F U 38 ? A U 39 12 1 Y 1 F G 44 A A G 46 13 1 Y 1 F C 44 B A C 47 14 1 Y 1 F C 44 C A C 48 15 1 Y 1 F C 44 D A C 49 16 1 Y 1 F A 44 E A A 50 17 1 Y 1 F A 44 F A A 51 18 1 Y 1 F U 44 G A U 52 19 1 Y 1 F A 44 H A A 53 20 1 Y 1 F G 44 I A G 54 21 1 Y 1 F G 44 J A G 55 22 1 Y 1 F G 44 K A G 56 23 1 Y 1 F C 44 L A C 57 24 1 Y 1 F U 44 M A U 58 25 1 Y 1 F G 70 ? A G 81 26 1 Y 1 F G 71 ? A G 82 27 1 Y 1 F U 72 ? A U 83 28 1 Y 1 F A 73 ? A A 84 29 1 Y 1 F C 74 ? A C 85 30 1 Y 1 F C 75 ? A C 86 31 1 Y 1 F A 76 ? A A 87 32 1 Y 1 A MET 1 ? B MET 1 33 1 Y 1 A SER 2 ? B SER 2 34 1 Y 1 A ASP 3 ? B ASP 3 35 1 Y 1 A GLN 4 ? B GLN 4 36 1 Y 1 A GLN 5 ? B GLN 5 37 1 Y 1 A GLN 6 ? B GLN 6 38 1 Y 1 A GLN 168 ? B GLN 168 39 1 Y 1 A CYS 169 ? B CYS 169 40 1 Y 1 A GLN 170 ? B GLN 170 41 1 Y 1 A SER 171 ? B SER 171 42 1 Y 1 A ARG 172 ? B ARG 172 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A OP3 O N N 1 A P P N N 2 A OP1 O N N 3 A OP2 O N N 4 A "O5'" O N N 5 A "C5'" C N N 6 A "C4'" C N R 7 A "O4'" O N N 8 A "C3'" C N S 9 A "O3'" O N N 10 A "C2'" C N R 11 A "O2'" O N N 12 A "C1'" C N R 13 A N9 N Y N 14 A C8 C Y N 15 A N7 N Y N 16 A C5 C Y N 17 A C6 C Y N 18 A N6 N N N 19 A N1 N Y N 20 A C2 C Y N 21 A N3 N Y N 22 A C4 C Y N 23 A HOP3 H N N 24 A HOP2 H N N 25 A "H5'" H N N 26 A "H5''" H N N 27 A "H4'" H N N 28 A "H3'" H N N 29 A "HO3'" H N N 30 A "H2'" H N N 31 A "HO2'" H N N 32 A "H1'" H N N 33 A H8 H N N 34 A H61 H N N 35 A H62 H N N 36 A H2 H N N 37 ALA N N N N 38 ALA CA C N S 39 ALA C C N N 40 ALA O O N N 41 ALA CB C N N 42 ALA OXT O N N 43 ALA H H N N 44 ALA H2 H N N 45 ALA HA H N N 46 ALA HB1 H N N 47 ALA HB2 H N N 48 ALA HB3 H N N 49 ALA HXT H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 C OP3 O N N 111 C P P N N 112 C OP1 O N N 113 C OP2 O N N 114 C "O5'" O N N 115 C "C5'" C N N 116 C "C4'" C N R 117 C "O4'" O N N 118 C "C3'" C N S 119 C "O3'" O N N 120 C "C2'" C N R 121 C "O2'" O N N 122 C "C1'" C N R 123 C N1 N N N 124 C C2 C N N 125 C O2 O N N 126 C N3 N N N 127 C C4 C N N 128 C N4 N N N 129 C C5 C N N 130 C C6 C N N 131 C HOP3 H N N 132 C HOP2 H N N 133 C "H5'" H N N 134 C "H5''" H N N 135 C "H4'" H N N 136 C "H3'" H N N 137 C "HO3'" H N N 138 C "H2'" H N N 139 C "HO2'" H N N 140 C "H1'" H N N 141 C H41 H N N 142 C H42 H N N 143 C H5 H N N 144 C H6 H N N 145 CYS N N N N 146 CYS CA C N R 147 CYS C C N N 148 CYS O O N N 149 CYS CB C N N 150 CYS SG S N N 151 CYS OXT O N N 152 CYS H H N N 153 CYS H2 H N N 154 CYS HA H N N 155 CYS HB2 H N N 156 CYS HB3 H N N 157 CYS HG H N N 158 CYS HXT H N N 159 G OP3 O N N 160 G P P N N 161 G OP1 O N N 162 G OP2 O N N 163 G "O5'" O N N 164 G "C5'" C N N 165 G "C4'" C N R 166 G "O4'" O N N 167 G "C3'" C N S 168 G "O3'" O N N 169 G "C2'" C N R 170 G "O2'" O N N 171 G "C1'" C N R 172 G N9 N Y N 173 G C8 C Y N 174 G N7 N Y N 175 G C5 C Y N 176 G C6 C N N 177 G O6 O N N 178 G N1 N N N 179 G C2 C N N 180 G N2 N N N 181 G N3 N N N 182 G C4 C Y N 183 G HOP3 H N N 184 G HOP2 H N N 185 G "H5'" H N N 186 G "H5''" H N N 187 G "H4'" H N N 188 G "H3'" H N N 189 G "HO3'" H N N 190 G "H2'" H N N 191 G "HO2'" H N N 192 G "H1'" H N N 193 G H8 H N N 194 G H1 H N N 195 G H21 H N N 196 G H22 H N N 197 GLN N N N N 198 GLN CA C N S 199 GLN C C N N 200 GLN O O N N 201 GLN CB C N N 202 GLN CG C N N 203 GLN CD C N N 204 GLN OE1 O N N 205 GLN NE2 N N N 206 GLN OXT O N N 207 GLN H H N N 208 GLN H2 H N N 209 GLN HA H N N 210 GLN HB2 H N N 211 GLN HB3 H N N 212 GLN HG2 H N N 213 GLN HG3 H N N 214 GLN HE21 H N N 215 GLN HE22 H N N 216 GLN HXT H N N 217 GLU N N N N 218 GLU CA C N S 219 GLU C C N N 220 GLU O O N N 221 GLU CB C N N 222 GLU CG C N N 223 GLU CD C N N 224 GLU OE1 O N N 225 GLU OE2 O N N 226 GLU OXT O N N 227 GLU H H N N 228 GLU H2 H N N 229 GLU HA H N N 230 GLU HB2 H N N 231 GLU HB3 H N N 232 GLU HG2 H N N 233 GLU HG3 H N N 234 GLU HE2 H N N 235 GLU HXT H N N 236 GLY N N N N 237 GLY CA C N N 238 GLY C C N N 239 GLY O O N N 240 GLY OXT O N N 241 GLY H H N N 242 GLY H2 H N N 243 GLY HA2 H N N 244 GLY HA3 H N N 245 GLY HXT H N N 246 HIS N N N N 247 HIS CA C N S 248 HIS C C N N 249 HIS O O N N 250 HIS CB C N N 251 HIS CG C Y N 252 HIS ND1 N Y N 253 HIS CD2 C Y N 254 HIS CE1 C Y N 255 HIS NE2 N Y N 256 HIS OXT O N N 257 HIS H H N N 258 HIS H2 H N N 259 HIS HA H N N 260 HIS HB2 H N N 261 HIS HB3 H N N 262 HIS HD1 H N N 263 HIS HD2 H N N 264 HIS HE1 H N N 265 HIS HE2 H N N 266 HIS HXT H N N 267 ILE N N N N 268 ILE CA C N S 269 ILE C C N N 270 ILE O O N N 271 ILE CB C N S 272 ILE CG1 C N N 273 ILE CG2 C N N 274 ILE CD1 C N N 275 ILE OXT O N N 276 ILE H H N N 277 ILE H2 H N N 278 ILE HA H N N 279 ILE HB H N N 280 ILE HG12 H N N 281 ILE HG13 H N N 282 ILE HG21 H N N 283 ILE HG22 H N N 284 ILE HG23 H N N 285 ILE HD11 H N N 286 ILE HD12 H N N 287 ILE HD13 H N N 288 ILE HXT H N N 289 K K K N N 290 LEU N N N N 291 LEU CA C N S 292 LEU C C N N 293 LEU O O N N 294 LEU CB C N N 295 LEU CG C N N 296 LEU CD1 C N N 297 LEU CD2 C N N 298 LEU OXT O N N 299 LEU H H N N 300 LEU H2 H N N 301 LEU HA H N N 302 LEU HB2 H N N 303 LEU HB3 H N N 304 LEU HG H N N 305 LEU HD11 H N N 306 LEU HD12 H N N 307 LEU HD13 H N N 308 LEU HD21 H N N 309 LEU HD22 H N N 310 LEU HD23 H N N 311 LEU HXT H N N 312 LYS N N N N 313 LYS CA C N S 314 LYS C C N N 315 LYS O O N N 316 LYS CB C N N 317 LYS CG C N N 318 LYS CD C N N 319 LYS CE C N N 320 LYS NZ N N N 321 LYS OXT O N N 322 LYS H H N N 323 LYS H2 H N N 324 LYS HA H N N 325 LYS HB2 H N N 326 LYS HB3 H N N 327 LYS HG2 H N N 328 LYS HG3 H N N 329 LYS HD2 H N N 330 LYS HD3 H N N 331 LYS HE2 H N N 332 LYS HE3 H N N 333 LYS HZ1 H N N 334 LYS HZ2 H N N 335 LYS HZ3 H N N 336 LYS HXT H N N 337 MET N N N N 338 MET CA C N S 339 MET C C N N 340 MET O O N N 341 MET CB C N N 342 MET CG C N N 343 MET SD S N N 344 MET CE C N N 345 MET OXT O N N 346 MET H H N N 347 MET H2 H N N 348 MET HA H N N 349 MET HB2 H N N 350 MET HB3 H N N 351 MET HG2 H N N 352 MET HG3 H N N 353 MET HE1 H N N 354 MET HE2 H N N 355 MET HE3 H N N 356 MET HXT H N N 357 PHE N N N N 358 PHE CA C N S 359 PHE C C N N 360 PHE O O N N 361 PHE CB C N N 362 PHE CG C Y N 363 PHE CD1 C Y N 364 PHE CD2 C Y N 365 PHE CE1 C Y N 366 PHE CE2 C Y N 367 PHE CZ C Y N 368 PHE OXT O N N 369 PHE H H N N 370 PHE H2 H N N 371 PHE HA H N N 372 PHE HB2 H N N 373 PHE HB3 H N N 374 PHE HD1 H N N 375 PHE HD2 H N N 376 PHE HE1 H N N 377 PHE HE2 H N N 378 PHE HZ H N N 379 PHE HXT H N N 380 PRO N N N N 381 PRO CA C N S 382 PRO C C N N 383 PRO O O N N 384 PRO CB C N N 385 PRO CG C N N 386 PRO CD C N N 387 PRO OXT O N N 388 PRO H H N N 389 PRO HA H N N 390 PRO HB2 H N N 391 PRO HB3 H N N 392 PRO HG2 H N N 393 PRO HG3 H N N 394 PRO HD2 H N N 395 PRO HD3 H N N 396 PRO HXT H N N 397 SER N N N N 398 SER CA C N S 399 SER C C N N 400 SER O O N N 401 SER CB C N N 402 SER OG O N N 403 SER OXT O N N 404 SER H H N N 405 SER H2 H N N 406 SER HA H N N 407 SER HB2 H N N 408 SER HB3 H N N 409 SER HG H N N 410 SER HXT H N N 411 THR N N N N 412 THR CA C N S 413 THR C C N N 414 THR O O N N 415 THR CB C N R 416 THR OG1 O N N 417 THR CG2 C N N 418 THR OXT O N N 419 THR H H N N 420 THR H2 H N N 421 THR HA H N N 422 THR HB H N N 423 THR HG1 H N N 424 THR HG21 H N N 425 THR HG22 H N N 426 THR HG23 H N N 427 THR HXT H N N 428 TRP N N N N 429 TRP CA C N S 430 TRP C C N N 431 TRP O O N N 432 TRP CB C N N 433 TRP CG C Y N 434 TRP CD1 C Y N 435 TRP CD2 C Y N 436 TRP NE1 N Y N 437 TRP CE2 C Y N 438 TRP CE3 C Y N 439 TRP CZ2 C Y N 440 TRP CZ3 C Y N 441 TRP CH2 C Y N 442 TRP OXT O N N 443 TRP H H N N 444 TRP H2 H N N 445 TRP HA H N N 446 TRP HB2 H N N 447 TRP HB3 H N N 448 TRP HD1 H N N 449 TRP HE1 H N N 450 TRP HE3 H N N 451 TRP HZ2 H N N 452 TRP HZ3 H N N 453 TRP HH2 H N N 454 TRP HXT H N N 455 TYR N N N N 456 TYR CA C N S 457 TYR C C N N 458 TYR O O N N 459 TYR CB C N N 460 TYR CG C Y N 461 TYR CD1 C Y N 462 TYR CD2 C Y N 463 TYR CE1 C Y N 464 TYR CE2 C Y N 465 TYR CZ C Y N 466 TYR OH O N N 467 TYR OXT O N N 468 TYR H H N N 469 TYR H2 H N N 470 TYR HA H N N 471 TYR HB2 H N N 472 TYR HB3 H N N 473 TYR HD1 H N N 474 TYR HD2 H N N 475 TYR HE1 H N N 476 TYR HE2 H N N 477 TYR HH H N N 478 TYR HXT H N N 479 U OP3 O N N 480 U P P N N 481 U OP1 O N N 482 U OP2 O N N 483 U "O5'" O N N 484 U "C5'" C N N 485 U "C4'" C N R 486 U "O4'" O N N 487 U "C3'" C N S 488 U "O3'" O N N 489 U "C2'" C N R 490 U "O2'" O N N 491 U "C1'" C N R 492 U N1 N N N 493 U C2 C N N 494 U O2 O N N 495 U N3 N N N 496 U C4 C N N 497 U O4 O N N 498 U C5 C N N 499 U C6 C N N 500 U HOP3 H N N 501 U HOP2 H N N 502 U "H5'" H N N 503 U "H5''" H N N 504 U "H4'" H N N 505 U "H3'" H N N 506 U "HO3'" H N N 507 U "H2'" H N N 508 U "HO2'" H N N 509 U "H1'" H N N 510 U H3 H N N 511 U H5 H N N 512 U H6 H N N 513 VAL N N N N 514 VAL CA C N S 515 VAL C C N N 516 VAL O O N N 517 VAL CB C N N 518 VAL CG1 C N N 519 VAL CG2 C N N 520 VAL OXT O N N 521 VAL H H N N 522 VAL H2 H N N 523 VAL HA H N N 524 VAL HB H N N 525 VAL HG11 H N N 526 VAL HG12 H N N 527 VAL HG13 H N N 528 VAL HG21 H N N 529 VAL HG22 H N N 530 VAL HG23 H N N 531 VAL HXT H N N 532 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A OP3 P sing N N 1 A OP3 HOP3 sing N N 2 A P OP1 doub N N 3 A P OP2 sing N N 4 A P "O5'" sing N N 5 A OP2 HOP2 sing N N 6 A "O5'" "C5'" sing N N 7 A "C5'" "C4'" sing N N 8 A "C5'" "H5'" sing N N 9 A "C5'" "H5''" sing N N 10 A "C4'" "O4'" sing N N 11 A "C4'" "C3'" sing N N 12 A "C4'" "H4'" sing N N 13 A "O4'" "C1'" sing N N 14 A "C3'" "O3'" sing N N 15 A "C3'" "C2'" sing N N 16 A "C3'" "H3'" sing N N 17 A "O3'" "HO3'" sing N N 18 A "C2'" "O2'" sing N N 19 A "C2'" "C1'" sing N N 20 A "C2'" "H2'" sing N N 21 A "O2'" "HO2'" sing N N 22 A "C1'" N9 sing N N 23 A "C1'" "H1'" sing N N 24 A N9 C8 sing Y N 25 A N9 C4 sing Y N 26 A C8 N7 doub Y N 27 A C8 H8 sing N N 28 A N7 C5 sing Y N 29 A C5 C6 sing Y N 30 A C5 C4 doub Y N 31 A C6 N6 sing N N 32 A C6 N1 doub Y N 33 A N6 H61 sing N N 34 A N6 H62 sing N N 35 A N1 C2 sing Y N 36 A C2 N3 doub Y N 37 A C2 H2 sing N N 38 A N3 C4 sing Y N 39 ALA N CA sing N N 40 ALA N H sing N N 41 ALA N H2 sing N N 42 ALA CA C sing N N 43 ALA CA CB sing N N 44 ALA CA HA sing N N 45 ALA C O doub N N 46 ALA C OXT sing N N 47 ALA CB HB1 sing N N 48 ALA CB HB2 sing N N 49 ALA CB HB3 sing N N 50 ALA OXT HXT sing N N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 C OP3 P sing N N 109 C OP3 HOP3 sing N N 110 C P OP1 doub N N 111 C P OP2 sing N N 112 C P "O5'" sing N N 113 C OP2 HOP2 sing N N 114 C "O5'" "C5'" sing N N 115 C "C5'" "C4'" sing N N 116 C "C5'" "H5'" sing N N 117 C "C5'" "H5''" sing N N 118 C "C4'" "O4'" sing N N 119 C "C4'" "C3'" sing N N 120 C "C4'" "H4'" sing N N 121 C "O4'" "C1'" sing N N 122 C "C3'" "O3'" sing N N 123 C "C3'" "C2'" sing N N 124 C "C3'" "H3'" sing N N 125 C "O3'" "HO3'" sing N N 126 C "C2'" "O2'" sing N N 127 C "C2'" "C1'" sing N N 128 C "C2'" "H2'" sing N N 129 C "O2'" "HO2'" sing N N 130 C "C1'" N1 sing N N 131 C "C1'" "H1'" sing N N 132 C N1 C2 sing N N 133 C N1 C6 sing N N 134 C C2 O2 doub N N 135 C C2 N3 sing N N 136 C N3 C4 doub N N 137 C C4 N4 sing N N 138 C C4 C5 sing N N 139 C N4 H41 sing N N 140 C N4 H42 sing N N 141 C C5 C6 doub N N 142 C C5 H5 sing N N 143 C C6 H6 sing N N 144 CYS N CA sing N N 145 CYS N H sing N N 146 CYS N H2 sing N N 147 CYS CA C sing N N 148 CYS CA CB sing N N 149 CYS CA HA sing N N 150 CYS C O doub N N 151 CYS C OXT sing N N 152 CYS CB SG sing N N 153 CYS CB HB2 sing N N 154 CYS CB HB3 sing N N 155 CYS SG HG sing N N 156 CYS OXT HXT sing N N 157 G OP3 P sing N N 158 G OP3 HOP3 sing N N 159 G P OP1 doub N N 160 G P OP2 sing N N 161 G P "O5'" sing N N 162 G OP2 HOP2 sing N N 163 G "O5'" "C5'" sing N N 164 G "C5'" "C4'" sing N N 165 G "C5'" "H5'" sing N N 166 G "C5'" "H5''" sing N N 167 G "C4'" "O4'" sing N N 168 G "C4'" "C3'" sing N N 169 G "C4'" "H4'" sing N N 170 G "O4'" "C1'" sing N N 171 G "C3'" "O3'" sing N N 172 G "C3'" "C2'" sing N N 173 G "C3'" "H3'" sing N N 174 G "O3'" "HO3'" sing N N 175 G "C2'" "O2'" sing N N 176 G "C2'" "C1'" sing N N 177 G "C2'" "H2'" sing N N 178 G "O2'" "HO2'" sing N N 179 G "C1'" N9 sing N N 180 G "C1'" "H1'" sing N N 181 G N9 C8 sing Y N 182 G N9 C4 sing Y N 183 G C8 N7 doub Y N 184 G C8 H8 sing N N 185 G N7 C5 sing Y N 186 G C5 C6 sing N N 187 G C5 C4 doub Y N 188 G C6 O6 doub N N 189 G C6 N1 sing N N 190 G N1 C2 sing N N 191 G N1 H1 sing N N 192 G C2 N2 sing N N 193 G C2 N3 doub N N 194 G N2 H21 sing N N 195 G N2 H22 sing N N 196 G N3 C4 sing N N 197 GLN N CA sing N N 198 GLN N H sing N N 199 GLN N H2 sing N N 200 GLN CA C sing N N 201 GLN CA CB sing N N 202 GLN CA HA sing N N 203 GLN C O doub N N 204 GLN C OXT sing N N 205 GLN CB CG sing N N 206 GLN CB HB2 sing N N 207 GLN CB HB3 sing N N 208 GLN CG CD sing N N 209 GLN CG HG2 sing N N 210 GLN CG HG3 sing N N 211 GLN CD OE1 doub N N 212 GLN CD NE2 sing N N 213 GLN NE2 HE21 sing N N 214 GLN NE2 HE22 sing N N 215 GLN OXT HXT sing N N 216 GLU N CA sing N N 217 GLU N H sing N N 218 GLU N H2 sing N N 219 GLU CA C sing N N 220 GLU CA CB sing N N 221 GLU CA HA sing N N 222 GLU C O doub N N 223 GLU C OXT sing N N 224 GLU CB CG sing N N 225 GLU CB HB2 sing N N 226 GLU CB HB3 sing N N 227 GLU CG CD sing N N 228 GLU CG HG2 sing N N 229 GLU CG HG3 sing N N 230 GLU CD OE1 doub N N 231 GLU CD OE2 sing N N 232 GLU OE2 HE2 sing N N 233 GLU OXT HXT sing N N 234 GLY N CA sing N N 235 GLY N H sing N N 236 GLY N H2 sing N N 237 GLY CA C sing N N 238 GLY CA HA2 sing N N 239 GLY CA HA3 sing N N 240 GLY C O doub N N 241 GLY C OXT sing N N 242 GLY OXT HXT sing N N 243 HIS N CA sing N N 244 HIS N H sing N N 245 HIS N H2 sing N N 246 HIS CA C sing N N 247 HIS CA CB sing N N 248 HIS CA HA sing N N 249 HIS C O doub N N 250 HIS C OXT sing N N 251 HIS CB CG sing N N 252 HIS CB HB2 sing N N 253 HIS CB HB3 sing N N 254 HIS CG ND1 sing Y N 255 HIS CG CD2 doub Y N 256 HIS ND1 CE1 doub Y N 257 HIS ND1 HD1 sing N N 258 HIS CD2 NE2 sing Y N 259 HIS CD2 HD2 sing N N 260 HIS CE1 NE2 sing Y N 261 HIS CE1 HE1 sing N N 262 HIS NE2 HE2 sing N N 263 HIS OXT HXT sing N N 264 ILE N CA sing N N 265 ILE N H sing N N 266 ILE N H2 sing N N 267 ILE CA C sing N N 268 ILE CA CB sing N N 269 ILE CA HA sing N N 270 ILE C O doub N N 271 ILE C OXT sing N N 272 ILE CB CG1 sing N N 273 ILE CB CG2 sing N N 274 ILE CB HB sing N N 275 ILE CG1 CD1 sing N N 276 ILE CG1 HG12 sing N N 277 ILE CG1 HG13 sing N N 278 ILE CG2 HG21 sing N N 279 ILE CG2 HG22 sing N N 280 ILE CG2 HG23 sing N N 281 ILE CD1 HD11 sing N N 282 ILE CD1 HD12 sing N N 283 ILE CD1 HD13 sing N N 284 ILE OXT HXT sing N N 285 LEU N CA sing N N 286 LEU N H sing N N 287 LEU N H2 sing N N 288 LEU CA C sing N N 289 LEU CA CB sing N N 290 LEU CA HA sing N N 291 LEU C O doub N N 292 LEU C OXT sing N N 293 LEU CB CG sing N N 294 LEU CB HB2 sing N N 295 LEU CB HB3 sing N N 296 LEU CG CD1 sing N N 297 LEU CG CD2 sing N N 298 LEU CG HG sing N N 299 LEU CD1 HD11 sing N N 300 LEU CD1 HD12 sing N N 301 LEU CD1 HD13 sing N N 302 LEU CD2 HD21 sing N N 303 LEU CD2 HD22 sing N N 304 LEU CD2 HD23 sing N N 305 LEU OXT HXT sing N N 306 LYS N CA sing N N 307 LYS N H sing N N 308 LYS N H2 sing N N 309 LYS CA C sing N N 310 LYS CA CB sing N N 311 LYS CA HA sing N N 312 LYS C O doub N N 313 LYS C OXT sing N N 314 LYS CB CG sing N N 315 LYS CB HB2 sing N N 316 LYS CB HB3 sing N N 317 LYS CG CD sing N N 318 LYS CG HG2 sing N N 319 LYS CG HG3 sing N N 320 LYS CD CE sing N N 321 LYS CD HD2 sing N N 322 LYS CD HD3 sing N N 323 LYS CE NZ sing N N 324 LYS CE HE2 sing N N 325 LYS CE HE3 sing N N 326 LYS NZ HZ1 sing N N 327 LYS NZ HZ2 sing N N 328 LYS NZ HZ3 sing N N 329 LYS OXT HXT sing N N 330 MET N CA sing N N 331 MET N H sing N N 332 MET N H2 sing N N 333 MET CA C sing N N 334 MET CA CB sing N N 335 MET CA HA sing N N 336 MET C O doub N N 337 MET C OXT sing N N 338 MET CB CG sing N N 339 MET CB HB2 sing N N 340 MET CB HB3 sing N N 341 MET CG SD sing N N 342 MET CG HG2 sing N N 343 MET CG HG3 sing N N 344 MET SD CE sing N N 345 MET CE HE1 sing N N 346 MET CE HE2 sing N N 347 MET CE HE3 sing N N 348 MET OXT HXT sing N N 349 PHE N CA sing N N 350 PHE N H sing N N 351 PHE N H2 sing N N 352 PHE CA C sing N N 353 PHE CA CB sing N N 354 PHE CA HA sing N N 355 PHE C O doub N N 356 PHE C OXT sing N N 357 PHE CB CG sing N N 358 PHE CB HB2 sing N N 359 PHE CB HB3 sing N N 360 PHE CG CD1 doub Y N 361 PHE CG CD2 sing Y N 362 PHE CD1 CE1 sing Y N 363 PHE CD1 HD1 sing N N 364 PHE CD2 CE2 doub Y N 365 PHE CD2 HD2 sing N N 366 PHE CE1 CZ doub Y N 367 PHE CE1 HE1 sing N N 368 PHE CE2 CZ sing Y N 369 PHE CE2 HE2 sing N N 370 PHE CZ HZ sing N N 371 PHE OXT HXT sing N N 372 PRO N CA sing N N 373 PRO N CD sing N N 374 PRO N H sing N N 375 PRO CA C sing N N 376 PRO CA CB sing N N 377 PRO CA HA sing N N 378 PRO C O doub N N 379 PRO C OXT sing N N 380 PRO CB CG sing N N 381 PRO CB HB2 sing N N 382 PRO CB HB3 sing N N 383 PRO CG CD sing N N 384 PRO CG HG2 sing N N 385 PRO CG HG3 sing N N 386 PRO CD HD2 sing N N 387 PRO CD HD3 sing N N 388 PRO OXT HXT sing N N 389 SER N CA sing N N 390 SER N H sing N N 391 SER N H2 sing N N 392 SER CA C sing N N 393 SER CA CB sing N N 394 SER CA HA sing N N 395 SER C O doub N N 396 SER C OXT sing N N 397 SER CB OG sing N N 398 SER CB HB2 sing N N 399 SER CB HB3 sing N N 400 SER OG HG sing N N 401 SER OXT HXT sing N N 402 THR N CA sing N N 403 THR N H sing N N 404 THR N H2 sing N N 405 THR CA C sing N N 406 THR CA CB sing N N 407 THR CA HA sing N N 408 THR C O doub N N 409 THR C OXT sing N N 410 THR CB OG1 sing N N 411 THR CB CG2 sing N N 412 THR CB HB sing N N 413 THR OG1 HG1 sing N N 414 THR CG2 HG21 sing N N 415 THR CG2 HG22 sing N N 416 THR CG2 HG23 sing N N 417 THR OXT HXT sing N N 418 TRP N CA sing N N 419 TRP N H sing N N 420 TRP N H2 sing N N 421 TRP CA C sing N N 422 TRP CA CB sing N N 423 TRP CA HA sing N N 424 TRP C O doub N N 425 TRP C OXT sing N N 426 TRP CB CG sing N N 427 TRP CB HB2 sing N N 428 TRP CB HB3 sing N N 429 TRP CG CD1 doub Y N 430 TRP CG CD2 sing Y N 431 TRP CD1 NE1 sing Y N 432 TRP CD1 HD1 sing N N 433 TRP CD2 CE2 doub Y N 434 TRP CD2 CE3 sing Y N 435 TRP NE1 CE2 sing Y N 436 TRP NE1 HE1 sing N N 437 TRP CE2 CZ2 sing Y N 438 TRP CE3 CZ3 doub Y N 439 TRP CE3 HE3 sing N N 440 TRP CZ2 CH2 doub Y N 441 TRP CZ2 HZ2 sing N N 442 TRP CZ3 CH2 sing Y N 443 TRP CZ3 HZ3 sing N N 444 TRP CH2 HH2 sing N N 445 TRP OXT HXT sing N N 446 TYR N CA sing N N 447 TYR N H sing N N 448 TYR N H2 sing N N 449 TYR CA C sing N N 450 TYR CA CB sing N N 451 TYR CA HA sing N N 452 TYR C O doub N N 453 TYR C OXT sing N N 454 TYR CB CG sing N N 455 TYR CB HB2 sing N N 456 TYR CB HB3 sing N N 457 TYR CG CD1 doub Y N 458 TYR CG CD2 sing Y N 459 TYR CD1 CE1 sing Y N 460 TYR CD1 HD1 sing N N 461 TYR CD2 CE2 doub Y N 462 TYR CD2 HD2 sing N N 463 TYR CE1 CZ doub Y N 464 TYR CE1 HE1 sing N N 465 TYR CE2 CZ sing Y N 466 TYR CE2 HE2 sing N N 467 TYR CZ OH sing N N 468 TYR OH HH sing N N 469 TYR OXT HXT sing N N 470 U OP3 P sing N N 471 U OP3 HOP3 sing N N 472 U P OP1 doub N N 473 U P OP2 sing N N 474 U P "O5'" sing N N 475 U OP2 HOP2 sing N N 476 U "O5'" "C5'" sing N N 477 U "C5'" "C4'" sing N N 478 U "C5'" "H5'" sing N N 479 U "C5'" "H5''" sing N N 480 U "C4'" "O4'" sing N N 481 U "C4'" "C3'" sing N N 482 U "C4'" "H4'" sing N N 483 U "O4'" "C1'" sing N N 484 U "C3'" "O3'" sing N N 485 U "C3'" "C2'" sing N N 486 U "C3'" "H3'" sing N N 487 U "O3'" "HO3'" sing N N 488 U "C2'" "O2'" sing N N 489 U "C2'" "C1'" sing N N 490 U "C2'" "H2'" sing N N 491 U "O2'" "HO2'" sing N N 492 U "C1'" N1 sing N N 493 U "C1'" "H1'" sing N N 494 U N1 C2 sing N N 495 U N1 C6 sing N N 496 U C2 O2 doub N N 497 U C2 N3 sing N N 498 U N3 C4 sing N N 499 U N3 H3 sing N N 500 U C4 O4 doub N N 501 U C4 C5 sing N N 502 U C5 C6 doub N N 503 U C5 H5 sing N N 504 U C6 H6 sing N N 505 VAL N CA sing N N 506 VAL N H sing N N 507 VAL N H2 sing N N 508 VAL CA C sing N N 509 VAL CA CB sing N N 510 VAL CA HA sing N N 511 VAL C O doub N N 512 VAL C OXT sing N N 513 VAL CB CG1 sing N N 514 VAL CB CG2 sing N N 515 VAL CB HB sing N N 516 VAL CG1 HG11 sing N N 517 VAL CG1 HG12 sing N N 518 VAL CG1 HG13 sing N N 519 VAL CG2 HG21 sing N N 520 VAL CG2 HG22 sing N N 521 VAL CG2 HG23 sing N N 522 VAL OXT HXT sing N N 523 # loop_ _ndb_struct_conf_na.entry_id _ndb_struct_conf_na.feature 2NRE 'double helix' 2NRE 'a-form double helix' 2NRE 'hairpin loop' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 A G 6 1_555 A C 78 1_555 1.186 0.381 -0.187 -12.164 -17.752 -0.334 1 F_G6:C67_F F 6 ? F 67 ? 19 1 1 A A 60 1_555 A U 76 1_555 1.074 0.026 -0.382 -3.994 1.190 0.379 2 F_A49:U65_F F 49 ? F 65 ? 20 1 1 A C 61 1_555 A G 75 1_555 -0.393 -0.227 0.223 -10.314 -16.655 7.162 3 F_C50:G64_F F 50 ? F 64 ? 19 1 1 A G 62 1_555 A C 74 1_555 1.142 0.200 0.979 11.928 -5.317 16.876 4 F_G51:C63_F F 51 ? F 63 ? ? 1 1 A G 63 1_555 A C 73 1_555 1.110 0.142 -0.329 -9.139 -8.988 0.735 5 F_G52:C62_F F 52 ? F 62 ? 19 1 1 A G 64 1_555 A C 72 1_555 0.570 -0.101 -0.578 -14.282 1.957 9.602 6 F_G53:C61_F F 53 ? F 61 ? 19 1 1 A U 65 1_555 A A 69 1_555 4.666 -1.871 1.209 3.597 23.618 -100.348 7 F_U54:A58_F F 54 ? F 58 ? ? ? 1 A U 66 1_555 A G 18 1_555 0.776 -6.155 0.208 27.262 44.260 -97.100 8 F_U55:G18_F F 55 ? F 18 ? ? 2 1 A C 26 1_555 A G 10 1_555 0.667 -0.589 -1.554 24.394 -22.962 -4.401 9 F_C25:G10_F F 25 ? F 10 ? 19 1 1 A G 27 1_555 A U 45 1_555 -1.331 1.571 -0.385 -22.199 -20.056 34.922 10 F_G26:U44_F F 26 ? F 44 ? ? ? 1 A U 29 1_555 A A 43 1_555 -1.680 0.309 -0.187 -15.669 -13.735 3.762 11 F_U28:A42_F F 28 ? F 42 ? ? ? 1 A A 30 1_555 A U 42 1_555 -0.730 -0.192 -0.818 -22.437 -17.554 -7.924 12 F_A29:U41_F F 29 ? F 41 ? 20 1 1 A C 31 1_555 A G 41 1_555 1.370 -0.329 0.215 4.412 -7.240 11.098 13 F_C30:G40_F F 30 ? F 40 ? 19 1 1 A C 32 1_555 A G 40 1_555 -2.580 0.570 -1.073 -3.919 49.763 12.454 14 F_C31:G39_F F 31 ? F 39 ? ? ? 1 A G 12 1_555 A C 24 1_555 -0.819 0.477 -0.108 -12.203 -13.907 -7.354 15 F_G12:C23_F F 12 ? F 23 ? ? ? 1 A A 15 1_555 A U 59 1_555 0.238 2.450 0.081 39.248 19.027 169.582 16 F_A15:U48_F F 15 ? F 48 ? 21 2 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 A G 6 1_555 A C 78 1_555 A A 60 1_555 A U 76 1_555 -2.303 -3.943 5.565 -5.365 17.467 61.926 -4.890 1.800 4.588 16.593 5.096 64.308 1 FF_G6A49:U65C67_FF F 6 ? F 67 ? F 49 ? F 65 ? 1 A A 60 1_555 A U 76 1_555 A C 61 1_555 A G 75 1_555 0.069 -1.648 3.289 -4.356 2.231 36.129 -2.941 -0.709 3.156 3.578 6.985 36.448 2 FF_A49C50:G64U65_FF F 49 ? F 65 ? F 50 ? F 64 ? 1 A C 61 1_555 A G 75 1_555 A G 62 1_555 A C 74 1_555 -0.438 -1.718 2.702 -2.146 -2.342 32.712 -2.696 0.462 2.837 -4.145 3.799 32.862 3 FF_C50G51:C63G64_FF F 50 ? F 64 ? F 51 ? F 63 ? 1 A G 62 1_555 A C 74 1_555 A G 63 1_555 A C 73 1_555 0.223 -1.978 3.605 12.147 10.314 27.289 -5.597 1.894 2.580 19.858 -23.389 31.524 4 FF_G51G52:C62C63_FF F 51 ? F 63 ? F 52 ? F 62 ? 1 A G 63 1_555 A C 73 1_555 A G 64 1_555 A C 72 1_555 1.010 -1.837 3.474 1.957 0.645 35.431 -3.114 -1.352 3.491 1.059 -3.213 35.489 5 FF_G52G53:C61C62_FF F 52 ? F 62 ? F 53 ? F 61 ? 1 A G 64 1_555 A C 72 1_555 A U 65 1_555 A A 69 1_555 -3.044 -2.153 2.870 1.065 7.570 82.219 -1.791 2.330 2.667 5.745 -0.808 82.511 6 FF_G53U54:A58C61_FF F 53 ? F 61 ? F 54 ? F 58 ? 1 A U 65 1_555 A A 69 1_555 A U 66 1_555 A G 18 1_555 1.390 -1.758 4.156 7.681 -2.113 44.480 -2.041 -0.904 4.400 -2.765 -10.051 45.152 7 FF_U54U55:G18A58_FF F 54 ? F 58 ? F 55 ? F 18 ? 1 A C 26 1_555 A G 10 1_555 A G 27 1_555 A U 45 1_555 2.170 -2.668 4.083 -1.719 35.021 22.887 -6.787 -3.200 -0.023 57.799 2.837 41.674 8 FF_C25G26:U44G10_FF F 25 ? F 10 ? F 26 ? F 44 ? 1 A G 27 1_555 A U 45 1_555 A U 29 1_555 A A 43 1_555 -0.321 -2.697 6.075 -12.210 23.980 69.691 -3.576 -0.415 5.046 20.246 10.309 74.089 9 FF_G26U28:A42U44_FF F 26 ? F 44 ? F 28 ? F 42 ? 1 A U 29 1_555 A A 43 1_555 A A 30 1_555 A U 42 1_555 0.132 -1.355 3.759 5.083 8.222 27.538 -4.657 0.953 3.203 16.637 -10.284 29.155 10 FF_U28A29:U41A42_FF F 28 ? F 42 ? F 29 ? F 41 ? 1 A A 30 1_555 A U 42 1_555 A C 31 1_555 A G 41 1_555 1.753 -0.200 2.468 -6.799 3.233 42.794 -0.494 -2.839 2.158 4.390 9.233 43.421 11 FF_A29C30:G40U41_FF F 29 ? F 41 ? F 30 ? F 40 ? 1 A C 31 1_555 A G 41 1_555 A C 32 1_555 A G 40 1_555 -1.176 -1.466 3.850 -1.280 21.618 15.720 -8.651 2.221 1.156 54.341 3.217 26.705 12 FF_C30C31:G39G40_FF F 30 ? F 40 ? F 31 ? F 39 ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'POTASSIUM ION' _pdbx_entity_nonpoly.comp_id K # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 1DJ0 '1DJ0 and 1EHZ' 2 ? 'experimental model' PDB 1EHZ '1DJ0 and 1EHZ' #