data_2NX8 # _entry.id 2NX8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2NX8 pdb_00002nx8 10.2210/pdb2nx8/pdb RCSB RCSB040414 ? ? WWPDB D_1000040414 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2NX8 _pdbx_database_status.recvd_initial_deposition_date 2006-11-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hwang, K.Y.' 1 'Lee, W.-H.' 2 'Kim, Y.K.' 3 # _citation.id primary _citation.title 'Crystal structure of the tRNA-specific adenosine deaminase from Streptococcus pyogenes' _citation.journal_abbrev Proteins _citation.journal_volume 68 _citation.page_first 1016 _citation.page_last 1019 _citation.year 2007 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17554781 _citation.pdbx_database_id_DOI 10.1002/prot.21456 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, W.-H.' 1 ? primary 'Kim, Y.K.' 2 ? primary 'Nam, K.H.' 3 ? primary 'Priyadarshi, A.' 4 ? primary 'Lee, E.H.' 5 ? primary 'Kim, E.E.' 6 ? primary 'Jeon, Y.H.' 7 ? primary 'Cheong, C.' 8 ? primary 'Hwang, K.Y.' 9 ? # _cell.entry_id 2NX8 _cell.length_a 80.091 _cell.length_b 80.091 _cell.length_c 81.104 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2NX8 _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TRNA-specific adenosine deaminase' 20237.133 1 3.5.4.- A27S/A122V ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 water nat water 18.015 138 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Hypothetical protein M6_Spy0214' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MELGESFLMPYSLEEQTYFMQEALKESEKSLQKAEIPIGCVIVKDGEIIGRGHNAREESNQAIMHAEMMAINEANAHEGN WRLLDTTLFVTIEPCVMCSGAIGLARIPHVIYGASNQKFGGVDSLYQILTDERLNHRVQVERGLLAADCANIMQTFFRQG RERKKIAKHLIKEQSDPFD ; _entity_poly.pdbx_seq_one_letter_code_can ;MELGESFLMPYSLEEQTYFMQEALKESEKSLQKAEIPIGCVIVKDGEIIGRGHNAREESNQAIMHAEMMAINEANAHEGN WRLLDTTLFVTIEPCVMCSGAIGLARIPHVIYGASNQKFGGVDSLYQILTDERLNHRVQVERGLLAADCANIMQTFFRQG RERKKIAKHLIKEQSDPFD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LEU n 1 4 GLY n 1 5 GLU n 1 6 SER n 1 7 PHE n 1 8 LEU n 1 9 MET n 1 10 PRO n 1 11 TYR n 1 12 SER n 1 13 LEU n 1 14 GLU n 1 15 GLU n 1 16 GLN n 1 17 THR n 1 18 TYR n 1 19 PHE n 1 20 MET n 1 21 GLN n 1 22 GLU n 1 23 ALA n 1 24 LEU n 1 25 LYS n 1 26 GLU n 1 27 SER n 1 28 GLU n 1 29 LYS n 1 30 SER n 1 31 LEU n 1 32 GLN n 1 33 LYS n 1 34 ALA n 1 35 GLU n 1 36 ILE n 1 37 PRO n 1 38 ILE n 1 39 GLY n 1 40 CYS n 1 41 VAL n 1 42 ILE n 1 43 VAL n 1 44 LYS n 1 45 ASP n 1 46 GLY n 1 47 GLU n 1 48 ILE n 1 49 ILE n 1 50 GLY n 1 51 ARG n 1 52 GLY n 1 53 HIS n 1 54 ASN n 1 55 ALA n 1 56 ARG n 1 57 GLU n 1 58 GLU n 1 59 SER n 1 60 ASN n 1 61 GLN n 1 62 ALA n 1 63 ILE n 1 64 MET n 1 65 HIS n 1 66 ALA n 1 67 GLU n 1 68 MET n 1 69 MET n 1 70 ALA n 1 71 ILE n 1 72 ASN n 1 73 GLU n 1 74 ALA n 1 75 ASN n 1 76 ALA n 1 77 HIS n 1 78 GLU n 1 79 GLY n 1 80 ASN n 1 81 TRP n 1 82 ARG n 1 83 LEU n 1 84 LEU n 1 85 ASP n 1 86 THR n 1 87 THR n 1 88 LEU n 1 89 PHE n 1 90 VAL n 1 91 THR n 1 92 ILE n 1 93 GLU n 1 94 PRO n 1 95 CYS n 1 96 VAL n 1 97 MET n 1 98 CYS n 1 99 SER n 1 100 GLY n 1 101 ALA n 1 102 ILE n 1 103 GLY n 1 104 LEU n 1 105 ALA n 1 106 ARG n 1 107 ILE n 1 108 PRO n 1 109 HIS n 1 110 VAL n 1 111 ILE n 1 112 TYR n 1 113 GLY n 1 114 ALA n 1 115 SER n 1 116 ASN n 1 117 GLN n 1 118 LYS n 1 119 PHE n 1 120 GLY n 1 121 GLY n 1 122 VAL n 1 123 ASP n 1 124 SER n 1 125 LEU n 1 126 TYR n 1 127 GLN n 1 128 ILE n 1 129 LEU n 1 130 THR n 1 131 ASP n 1 132 GLU n 1 133 ARG n 1 134 LEU n 1 135 ASN n 1 136 HIS n 1 137 ARG n 1 138 VAL n 1 139 GLN n 1 140 VAL n 1 141 GLU n 1 142 ARG n 1 143 GLY n 1 144 LEU n 1 145 LEU n 1 146 ALA n 1 147 ALA n 1 148 ASP n 1 149 CYS n 1 150 ALA n 1 151 ASN n 1 152 ILE n 1 153 MET n 1 154 GLN n 1 155 THR n 1 156 PHE n 1 157 PHE n 1 158 ARG n 1 159 GLN n 1 160 GLY n 1 161 ARG n 1 162 GLU n 1 163 ARG n 1 164 LYS n 1 165 LYS n 1 166 ILE n 1 167 ALA n 1 168 LYS n 1 169 HIS n 1 170 LEU n 1 171 ILE n 1 172 LYS n 1 173 GLU n 1 174 GLN n 1 175 SER n 1 176 ASP n 1 177 PRO n 1 178 PHE n 1 179 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Streptococcus pyogenes' _entity_src_gen.gene_src_strain MGAS10394 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus pyogenes serotype M6' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 301450 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL 21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET 22b' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y214_STRP6 _struct_ref.pdbx_db_accession Q5XE14 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPYSLEEQTYFMQEALKEAEKSLQKAEIPIGCVIVKDGEIIGRGHNAREESNQAIMHAEMMAINEANAHEGNWRLLDTTL FVTIEPCVMCSGAIGLARIPHVIYGASNQKFGGADSLYQILTDERLNHRVQVERGLLAADCANIMQTFFRQGRERKKIAK HLIKEQSDPFD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2NX8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 179 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5XE14 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 171 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 9 _struct_ref_seq.pdbx_auth_seq_align_end 179 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2NX8 MET A 1 ? UNP Q5XE14 ? ? 'SEE REMARK 999' 1 1 1 2NX8 GLU A 2 ? UNP Q5XE14 ? ? 'SEE REMARK 999' 2 2 1 2NX8 LEU A 3 ? UNP Q5XE14 ? ? 'SEE REMARK 999' 3 3 1 2NX8 GLY A 4 ? UNP Q5XE14 ? ? 'SEE REMARK 999' 4 4 1 2NX8 GLU A 5 ? UNP Q5XE14 ? ? 'SEE REMARK 999' 5 5 1 2NX8 SER A 6 ? UNP Q5XE14 ? ? 'SEE REMARK 999' 6 6 1 2NX8 PHE A 7 ? UNP Q5XE14 ? ? 'SEE REMARK 999' 7 7 1 2NX8 LEU A 8 ? UNP Q5XE14 ? ? 'SEE REMARK 999' 8 8 1 2NX8 SER A 27 ? UNP Q5XE14 ALA 19 'engineered mutation' 27 9 1 2NX8 VAL A 122 ? UNP Q5XE14 ALA 114 'engineered mutation' 122 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 2NX8 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 5 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.3 _exptl_crystal.density_percent_sol 62.7 _exptl_crystal.description 'The file contains Friedel pairs.' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '0.1M HEPES, 2% PEG 1000, 1.7M Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 77 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2004-12-08 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator Wiggler _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.2834 1.0 2 1.2827 1.0 3 1.2573 1.0 4 1.28 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PAL/PLS BEAMLINE 4A' _diffrn_source.pdbx_synchrotron_site PAL/PLS _diffrn_source.pdbx_synchrotron_beamline 4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '1.2834, 1.2827, 1.2573, 1.28' # _reflns.entry_id 2NX8 _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 20 _reflns.d_resolution_high 2.0 _reflns.number_obs 30630 _reflns.number_all ? _reflns.percent_possible_obs 89.9 _reflns.pdbx_Rmerge_I_obs 0.081 _reflns.pdbx_Rsym_value 0.078 _reflns.pdbx_netI_over_sigmaI 29.6 _reflns.B_iso_Wilson_estimate 15.0 _reflns.pdbx_redundancy 4.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 89.9 _reflns_shell.Rmerge_I_obs 0.081 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2NX8 _refine.ls_number_reflns_obs 30630 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 349075.33 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.66 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 89.9 _refine.ls_R_factor_obs 0.214 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.214 _refine.ls_R_factor_R_free 0.242 _refine.ls_R_factor_R_free_error 0.006 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 1482 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 34.1 _refine.aniso_B[1][1] 2.78 _refine.aniso_B[2][2] 2.78 _refine.aniso_B[3][3] -5.56 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.403394 _refine.solvent_model_param_bsol 52.1025 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'The file contains Friedel pairs.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2NX8 _refine_analyze.Luzzati_coordinate_error_obs 0.24 _refine_analyze.Luzzati_sigma_a_obs 0.29 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.28 _refine_analyze.Luzzati_sigma_a_free 0.28 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1326 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 138 _refine_hist.number_atoms_total 1470 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 19.66 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.0 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 21.2 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.62 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.00 _refine_ls_shell.d_res_low 2.13 _refine_ls_shell.number_reflns_R_work 3689 _refine_ls_shell.R_factor_R_work 0.3 _refine_ls_shell.percent_reflns_obs 68.5 _refine_ls_shell.R_factor_R_free 0.309 _refine_ls_shell.R_factor_R_free_error 0.023 _refine_ls_shell.percent_reflns_R_free 4.7 _refine_ls_shell.number_reflns_R_free 181 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 3 water_rep.param water.top 'X-RAY DIFFRACTION' 4 ion.param ion.top 'X-RAY DIFFRACTION' 5 po4.par po4.top 'X-RAY DIFFRACTION' # _struct.entry_id 2NX8 _struct.title 'The crystal structure of the tRNA-specific adenosine deaminase from Streptococcus pyogenes' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2NX8 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'tRNA, adenosine, deaminase, tad, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 12 ? LYS A 33 ? SER A 12 LYS A 33 1 ? 22 HELX_P HELX_P2 2 ALA A 55 ? ASN A 60 ? ALA A 55 ASN A 60 1 ? 6 HELX_P HELX_P3 3 HIS A 65 ? GLY A 79 ? HIS A 65 GLY A 79 1 ? 15 HELX_P HELX_P4 4 CYS A 95 ? ALA A 105 ? CYS A 95 ALA A 105 1 ? 11 HELX_P HELX_P5 5 GLN A 127 ? ASP A 131 ? GLN A 127 ASP A 131 5 ? 5 HELX_P HELX_P6 6 LEU A 145 ? GLU A 173 ? LEU A 145 GLU A 173 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 65 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 65 A ZN 999 1_555 ? ? ? ? ? ? ? 2.167 ? ? metalc2 metalc ? ? A CYS 95 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 95 A ZN 999 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc3 metalc ? ? A CYS 98 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 98 A ZN 999 1_555 ? ? ? ? ? ? ? 2.348 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 47 ? HIS A 53 ? GLU A 47 HIS A 53 A 2 GLY A 39 ? LYS A 44 ? GLY A 39 LYS A 44 A 3 THR A 86 ? ILE A 92 ? THR A 86 ILE A 92 A 4 HIS A 109 ? ALA A 114 ? HIS A 109 ALA A 114 A 5 GLN A 139 ? ARG A 142 ? GLN A 139 ARG A 142 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 47 ? O GLU A 47 N LYS A 44 ? N LYS A 44 A 2 3 N VAL A 43 ? N VAL A 43 O THR A 87 ? O THR A 87 A 3 4 N LEU A 88 ? N LEU A 88 O ILE A 111 ? O ILE A 111 A 4 5 N VAL A 110 ? N VAL A 110 O GLU A 141 ? O GLU A 141 # _database_PDB_matrix.entry_id 2NX8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2NX8 _atom_sites.fract_transf_matrix[1][1] 0.012486 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012486 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012330 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 GLY 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 TRP 81 81 81 TRP TRP A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 CYS 149 149 149 CYS CYS A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 MET 153 153 153 MET MET A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 HIS 169 169 169 HIS HIS A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 GLN 174 174 ? ? ? A . n A 1 175 SER 175 175 ? ? ? A . n A 1 176 ASP 176 176 ? ? ? A . n A 1 177 PRO 177 177 ? ? ? A . n A 1 178 PHE 178 178 ? ? ? A . n A 1 179 ASP 179 179 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 999 999 ZN ZN A . C 3 PO4 1 2055 2055 PO4 PO4 A . D 4 HOH 1 2056 1 HOH TIP A . D 4 HOH 2 2057 2 HOH TIP A . D 4 HOH 3 2058 3 HOH TIP A . D 4 HOH 4 2059 4 HOH TIP A . D 4 HOH 5 2060 5 HOH TIP A . D 4 HOH 6 2061 6 HOH TIP A . D 4 HOH 7 2062 7 HOH TIP A . D 4 HOH 8 2063 8 HOH TIP A . D 4 HOH 9 2064 9 HOH TIP A . D 4 HOH 10 2065 10 HOH TIP A . D 4 HOH 11 2066 11 HOH TIP A . D 4 HOH 12 2067 13 HOH TIP A . D 4 HOH 13 2068 16 HOH TIP A . D 4 HOH 14 2069 17 HOH TIP A . D 4 HOH 15 2070 18 HOH TIP A . D 4 HOH 16 2071 19 HOH TIP A . D 4 HOH 17 2072 20 HOH TIP A . D 4 HOH 18 2073 21 HOH TIP A . D 4 HOH 19 2074 22 HOH TIP A . D 4 HOH 20 2075 23 HOH TIP A . D 4 HOH 21 2076 24 HOH TIP A . D 4 HOH 22 2077 26 HOH TIP A . D 4 HOH 23 2078 27 HOH TIP A . D 4 HOH 24 2079 28 HOH TIP A . D 4 HOH 25 2080 29 HOH TIP A . D 4 HOH 26 2081 30 HOH TIP A . D 4 HOH 27 2082 31 HOH TIP A . D 4 HOH 28 2083 32 HOH TIP A . D 4 HOH 29 2084 33 HOH TIP A . D 4 HOH 30 2085 34 HOH TIP A . D 4 HOH 31 2086 35 HOH TIP A . D 4 HOH 32 2087 36 HOH TIP A . D 4 HOH 33 2088 38 HOH TIP A . D 4 HOH 34 2089 39 HOH TIP A . D 4 HOH 35 2090 40 HOH TIP A . D 4 HOH 36 2091 41 HOH TIP A . D 4 HOH 37 2092 42 HOH TIP A . D 4 HOH 38 2093 43 HOH TIP A . D 4 HOH 39 2094 44 HOH TIP A . D 4 HOH 40 2095 45 HOH TIP A . D 4 HOH 41 2096 46 HOH TIP A . D 4 HOH 42 2097 47 HOH TIP A . D 4 HOH 43 2098 48 HOH TIP A . D 4 HOH 44 2099 49 HOH TIP A . D 4 HOH 45 2100 50 HOH TIP A . D 4 HOH 46 2101 51 HOH TIP A . D 4 HOH 47 2102 52 HOH TIP A . D 4 HOH 48 2103 53 HOH TIP A . D 4 HOH 49 2104 55 HOH TIP A . D 4 HOH 50 2105 56 HOH TIP A . D 4 HOH 51 2106 57 HOH TIP A . D 4 HOH 52 2107 58 HOH TIP A . D 4 HOH 53 2108 59 HOH TIP A . D 4 HOH 54 2109 60 HOH TIP A . D 4 HOH 55 2110 61 HOH TIP A . D 4 HOH 56 2111 62 HOH TIP A . D 4 HOH 57 2112 63 HOH TIP A . D 4 HOH 58 2113 64 HOH TIP A . D 4 HOH 59 2114 65 HOH TIP A . D 4 HOH 60 2115 66 HOH TIP A . D 4 HOH 61 2116 67 HOH TIP A . D 4 HOH 62 2117 68 HOH TIP A . D 4 HOH 63 2118 69 HOH TIP A . D 4 HOH 64 2119 70 HOH TIP A . D 4 HOH 65 2120 71 HOH TIP A . D 4 HOH 66 2121 72 HOH TIP A . D 4 HOH 67 2122 73 HOH TIP A . D 4 HOH 68 2123 74 HOH TIP A . D 4 HOH 69 2124 75 HOH TIP A . D 4 HOH 70 2125 76 HOH TIP A . D 4 HOH 71 2126 77 HOH TIP A . D 4 HOH 72 2127 78 HOH TIP A . D 4 HOH 73 2128 79 HOH TIP A . D 4 HOH 74 2129 80 HOH TIP A . D 4 HOH 75 2130 81 HOH TIP A . D 4 HOH 76 2131 82 HOH TIP A . D 4 HOH 77 2132 83 HOH TIP A . D 4 HOH 78 2133 84 HOH TIP A . D 4 HOH 79 2134 85 HOH TIP A . D 4 HOH 80 2135 86 HOH TIP A . D 4 HOH 81 2136 87 HOH TIP A . D 4 HOH 82 2137 88 HOH TIP A . D 4 HOH 83 2138 89 HOH TIP A . D 4 HOH 84 2139 91 HOH TIP A . D 4 HOH 85 2140 92 HOH TIP A . D 4 HOH 86 2141 93 HOH TIP A . D 4 HOH 87 2142 94 HOH TIP A . D 4 HOH 88 2143 96 HOH TIP A . D 4 HOH 89 2144 97 HOH TIP A . D 4 HOH 90 2145 98 HOH TIP A . D 4 HOH 91 2146 99 HOH TIP A . D 4 HOH 92 2147 100 HOH TIP A . D 4 HOH 93 2148 101 HOH TIP A . D 4 HOH 94 2149 102 HOH TIP A . D 4 HOH 95 2150 103 HOH TIP A . D 4 HOH 96 2151 104 HOH TIP A . D 4 HOH 97 2152 106 HOH TIP A . D 4 HOH 98 2153 107 HOH TIP A . D 4 HOH 99 2154 108 HOH TIP A . D 4 HOH 100 2155 109 HOH TIP A . D 4 HOH 101 2156 110 HOH TIP A . D 4 HOH 102 2157 111 HOH TIP A . D 4 HOH 103 2158 112 HOH TIP A . D 4 HOH 104 2159 113 HOH TIP A . D 4 HOH 105 2160 114 HOH TIP A . D 4 HOH 106 2161 115 HOH TIP A . D 4 HOH 107 2162 116 HOH TIP A . D 4 HOH 108 2163 117 HOH TIP A . D 4 HOH 109 2164 118 HOH TIP A . D 4 HOH 110 2165 119 HOH TIP A . D 4 HOH 111 2166 120 HOH TIP A . D 4 HOH 112 2167 121 HOH TIP A . D 4 HOH 113 2168 122 HOH TIP A . D 4 HOH 114 2169 123 HOH TIP A . D 4 HOH 115 2170 124 HOH TIP A . D 4 HOH 116 2171 125 HOH TIP A . D 4 HOH 117 2172 126 HOH TIP A . D 4 HOH 118 2173 127 HOH TIP A . D 4 HOH 119 2174 128 HOH TIP A . D 4 HOH 120 2175 129 HOH TIP A . D 4 HOH 121 2176 130 HOH TIP A . D 4 HOH 122 2177 131 HOH TIP A . D 4 HOH 123 2178 132 HOH TIP A . D 4 HOH 124 2179 133 HOH TIP A . D 4 HOH 125 2180 134 HOH TIP A . D 4 HOH 126 2181 135 HOH TIP A . D 4 HOH 127 2182 136 HOH TIP A . D 4 HOH 128 2183 137 HOH TIP A . D 4 HOH 129 2184 138 HOH TIP A . D 4 HOH 130 2185 139 HOH TIP A . D 4 HOH 131 2186 140 HOH TIP A . D 4 HOH 132 2187 141 HOH TIP A . D 4 HOH 133 2188 142 HOH TIP A . D 4 HOH 134 2189 143 HOH TIP A . D 4 HOH 135 2190 144 HOH TIP A . D 4 HOH 136 2191 145 HOH TIP A . D 4 HOH 137 2192 146 HOH TIP A . D 4 HOH 138 2193 147 HOH TIP A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3480 ? 1 MORE -115 ? 1 'SSA (A^2)' 16330 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 65 ? A HIS 65 ? 1_555 ZN ? B ZN . ? A ZN 999 ? 1_555 SG ? A CYS 95 ? A CYS 95 ? 1_555 110.3 ? 2 ND1 ? A HIS 65 ? A HIS 65 ? 1_555 ZN ? B ZN . ? A ZN 999 ? 1_555 SG ? A CYS 98 ? A CYS 98 ? 1_555 115.1 ? 3 SG ? A CYS 95 ? A CYS 95 ? 1_555 ZN ? B ZN . ? A ZN 999 ? 1_555 SG ? A CYS 98 ? A CYS 98 ? 1_555 121.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' struct_conn 3 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 4 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 5 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 6 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 7 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 9 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 10 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 11 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 12 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 ADSC 'data collection' Quantum ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 SOLVE phasing . ? 5 # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE The first 8 residues(MELGESFL) are not present in UniProt entry(Q5XE14 Y214_STRP6), though are present in the original translation from the underlying genomic DNA sequence. ; # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 2145 ? ? 1_555 O A HOH 2145 ? ? 2_565 1.26 2 1 O A HOH 2066 ? ? 1_555 O A HOH 2066 ? ? 7_555 1.41 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 55 ? ? -148.03 37.66 2 1 ASP A 123 ? ? -136.07 -41.01 3 1 SER A 124 ? ? -60.47 -78.34 4 1 ASN A 135 ? ? 55.89 17.77 5 1 LYS A 172 ? ? -53.56 -75.22 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A GLY 4 ? A GLY 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A GLN 174 ? A GLN 174 7 1 Y 1 A SER 175 ? A SER 175 8 1 Y 1 A ASP 176 ? A ASP 176 9 1 Y 1 A PRO 177 ? A PRO 177 10 1 Y 1 A PHE 178 ? A PHE 178 11 1 Y 1 A ASP 179 ? A ASP 179 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'PHOSPHATE ION' PO4 4 water HOH #