data_5EVD # _entry.id 5EVD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5EVD pdb_00005evd 10.2210/pdb5evd/pdb WWPDB D_1000215576 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-01 2 'Structure model' 1 1 2016-07-20 3 'Structure model' 1 2 2021-04-14 4 'Structure model' 1 3 2022-03-30 5 'Structure model' 1 4 2024-01-10 6 'Structure model' 1 5 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Derived calculations' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Refinement description' 8 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_struct_assembly 2 3 'Structure model' pdbx_struct_assembly_gen 3 3 'Structure model' pdbx_struct_assembly_prop 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_conn 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_audit_support 8 4 'Structure model' pdbx_struct_oper_list 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond 11 5 'Structure model' pdbx_initial_refinement_model 12 6 'Structure model' pdbx_entry_details 13 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_struct_assembly.details' 2 3 'Structure model' '_pdbx_struct_assembly.method_details' 3 3 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 4 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 5 3 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 6 3 'Structure model' '_struct_conn.pdbx_dist_value' 7 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 8 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 9 4 'Structure model' '_database_2.pdbx_DOI' 10 4 'Structure model' '_database_2.pdbx_database_accession' 11 4 'Structure model' '_pdbx_audit_support.funding_organization' 12 4 'Structure model' '_pdbx_struct_oper_list.name' 13 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5EVD _pdbx_database_status.recvd_initial_deposition_date 2015-11-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hinchliffe, P.' 1 'Spencer, J.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 113 _citation.language ? _citation.page_first E3745 _citation.page_last E3754 _citation.title 'Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1601368113 _citation.pdbx_database_id_PubMed 27303030 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hinchliffe, P.' 1 ? primary 'Gonzalez, M.M.' 2 ? primary 'Mojica, M.F.' 3 ? primary 'Gonzalez, J.M.' 4 ? primary 'Castillo, V.' 5 ? primary 'Saiz, C.' 6 ? primary 'Kosmopoulou, M.' 7 ? primary 'Tooke, C.L.' 8 ? primary 'Llarrull, L.I.' 9 ? primary 'Mahler, G.' 10 ? primary 'Bonomo, R.A.' 11 ? primary 'Vila, A.J.' 12 ? primary 'Spencer, J.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Metallo-beta-lactamase L1' 28894.619 1 3.5.2.6 ? ? ? 2 non-polymer syn '(3S,5S,7aR)-2,2-dimethyl-5-(sulfanylmethyl)tetrahydro[1,3]thiazolo[4,3-b][1,3]thiazole-3-carboxylic acid' 265.416 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 5 water nat water 18.015 271 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Beta-lactamase type II,Penicillinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPAEVPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLR LILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMA GHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGAR AGAKALTCKAYADAAEQKFDGQLAKETAGAR ; _entity_poly.pdbx_seq_one_letter_code_can ;GPAEVPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLR LILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMA GHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGAR AGAKALTCKAYADAAEQKFDGQLAKETAGAR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(3S,5S,7aR)-2,2-dimethyl-5-(sulfanylmethyl)tetrahydro[1,3]thiazolo[4,3-b][1,3]thiazole-3-carboxylic acid' VC2 3 'ZINC ION' ZN 4 'SULFATE ION' SO4 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 ALA n 1 4 GLU n 1 5 VAL n 1 6 PRO n 1 7 LEU n 1 8 PRO n 1 9 GLN n 1 10 LEU n 1 11 ARG n 1 12 ALA n 1 13 TYR n 1 14 THR n 1 15 VAL n 1 16 ASP n 1 17 ALA n 1 18 SER n 1 19 TRP n 1 20 LEU n 1 21 GLN n 1 22 PRO n 1 23 MET n 1 24 ALA n 1 25 PRO n 1 26 LEU n 1 27 GLN n 1 28 ILE n 1 29 ALA n 1 30 ASP n 1 31 HIS n 1 32 THR n 1 33 TRP n 1 34 GLN n 1 35 ILE n 1 36 GLY n 1 37 THR n 1 38 GLU n 1 39 ASP n 1 40 LEU n 1 41 THR n 1 42 ALA n 1 43 LEU n 1 44 LEU n 1 45 VAL n 1 46 GLN n 1 47 THR n 1 48 PRO n 1 49 ASP n 1 50 GLY n 1 51 ALA n 1 52 VAL n 1 53 LEU n 1 54 LEU n 1 55 ASP n 1 56 GLY n 1 57 GLY n 1 58 MET n 1 59 PRO n 1 60 GLN n 1 61 MET n 1 62 ALA n 1 63 SER n 1 64 HIS n 1 65 LEU n 1 66 LEU n 1 67 ASP n 1 68 ASN n 1 69 MET n 1 70 LYS n 1 71 ALA n 1 72 ARG n 1 73 GLY n 1 74 VAL n 1 75 THR n 1 76 PRO n 1 77 ARG n 1 78 ASP n 1 79 LEU n 1 80 ARG n 1 81 LEU n 1 82 ILE n 1 83 LEU n 1 84 LEU n 1 85 SER n 1 86 HIS n 1 87 ALA n 1 88 HIS n 1 89 ALA n 1 90 ASP n 1 91 HIS n 1 92 ALA n 1 93 GLY n 1 94 PRO n 1 95 VAL n 1 96 ALA n 1 97 GLU n 1 98 LEU n 1 99 LYS n 1 100 ARG n 1 101 ARG n 1 102 THR n 1 103 GLY n 1 104 ALA n 1 105 LYS n 1 106 VAL n 1 107 ALA n 1 108 ALA n 1 109 ASN n 1 110 ALA n 1 111 GLU n 1 112 SER n 1 113 ALA n 1 114 VAL n 1 115 LEU n 1 116 LEU n 1 117 ALA n 1 118 ARG n 1 119 GLY n 1 120 GLY n 1 121 SER n 1 122 ASP n 1 123 ASP n 1 124 LEU n 1 125 HIS n 1 126 PHE n 1 127 GLY n 1 128 ASP n 1 129 GLY n 1 130 ILE n 1 131 THR n 1 132 TYR n 1 133 PRO n 1 134 PRO n 1 135 ALA n 1 136 ASN n 1 137 ALA n 1 138 ASP n 1 139 ARG n 1 140 ILE n 1 141 VAL n 1 142 MET n 1 143 ASP n 1 144 GLY n 1 145 GLU n 1 146 VAL n 1 147 ILE n 1 148 THR n 1 149 VAL n 1 150 GLY n 1 151 GLY n 1 152 ILE n 1 153 VAL n 1 154 PHE n 1 155 THR n 1 156 ALA n 1 157 HIS n 1 158 PHE n 1 159 MET n 1 160 ALA n 1 161 GLY n 1 162 HIS n 1 163 THR n 1 164 PRO n 1 165 GLY n 1 166 SER n 1 167 THR n 1 168 ALA n 1 169 TRP n 1 170 THR n 1 171 TRP n 1 172 THR n 1 173 ASP n 1 174 THR n 1 175 ARG n 1 176 ASN n 1 177 GLY n 1 178 LYS n 1 179 PRO n 1 180 VAL n 1 181 ARG n 1 182 ILE n 1 183 ALA n 1 184 TYR n 1 185 ALA n 1 186 ASP n 1 187 SER n 1 188 LEU n 1 189 SER n 1 190 ALA n 1 191 PRO n 1 192 GLY n 1 193 TYR n 1 194 GLN n 1 195 LEU n 1 196 GLN n 1 197 GLY n 1 198 ASN n 1 199 PRO n 1 200 ARG n 1 201 TYR n 1 202 PRO n 1 203 HIS n 1 204 LEU n 1 205 ILE n 1 206 GLU n 1 207 ASP n 1 208 TYR n 1 209 ARG n 1 210 ARG n 1 211 SER n 1 212 PHE n 1 213 ALA n 1 214 THR n 1 215 VAL n 1 216 ARG n 1 217 ALA n 1 218 LEU n 1 219 PRO n 1 220 CYS n 1 221 ASP n 1 222 VAL n 1 223 LEU n 1 224 LEU n 1 225 THR n 1 226 PRO n 1 227 HIS n 1 228 PRO n 1 229 GLY n 1 230 ALA n 1 231 SER n 1 232 ASN n 1 233 TRP n 1 234 ASP n 1 235 TYR n 1 236 ALA n 1 237 ALA n 1 238 GLY n 1 239 ALA n 1 240 ARG n 1 241 ALA n 1 242 GLY n 1 243 ALA n 1 244 LYS n 1 245 ALA n 1 246 LEU n 1 247 THR n 1 248 CYS n 1 249 LYS n 1 250 ALA n 1 251 TYR n 1 252 ALA n 1 253 ASP n 1 254 ALA n 1 255 ALA n 1 256 GLU n 1 257 GLN n 1 258 LYS n 1 259 PHE n 1 260 ASP n 1 261 GLY n 1 262 GLN n 1 263 LEU n 1 264 ALA n 1 265 LYS n 1 266 GLU n 1 267 THR n 1 268 ALA n 1 269 GLY n 1 270 ALA n 1 271 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 271 _entity_src_gen.gene_src_common_name 'Pseudomonas maltophilia' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Stenotrophomonas maltophilia' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 40324 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant solu _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pOPIN-F _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 VC2 non-polymer . '(3S,5S,7aR)-2,2-dimethyl-5-(sulfanylmethyl)tetrahydro[1,3]thiazolo[4,3-b][1,3]thiazole-3-carboxylic acid' ? 'C9 H15 N O2 S3' 265.416 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 21 ? ? ? A . n A 1 2 PRO 2 22 ? ? ? A . n A 1 3 ALA 3 23 23 ALA ALA A . n A 1 4 GLU 4 24 24 GLU GLU A . n A 1 5 VAL 5 25 25 VAL VAL A . n A 1 6 PRO 6 26 26 PRO PRO A . n A 1 7 LEU 7 27 27 LEU LEU A . n A 1 8 PRO 8 28 28 PRO PRO A . n A 1 9 GLN 9 29 29 GLN GLN A . n A 1 10 LEU 10 30 30 LEU LEU A . n A 1 11 ARG 11 31 31 ARG ARG A . n A 1 12 ALA 12 32 32 ALA ALA A . n A 1 13 TYR 13 33 33 TYR TYR A . n A 1 14 THR 14 34 34 THR THR A . n A 1 15 VAL 15 35 35 VAL VAL A . n A 1 16 ASP 16 36 36 ASP ASP A . n A 1 17 ALA 17 37 37 ALA ALA A . n A 1 18 SER 18 38 38 SER SER A . n A 1 19 TRP 19 39 39 TRP TRP A . n A 1 20 LEU 20 40 40 LEU LEU A . n A 1 21 GLN 21 41 41 GLN GLN A . n A 1 22 PRO 22 42 42 PRO PRO A . n A 1 23 MET 23 43 43 MET MET A . n A 1 24 ALA 24 44 44 ALA ALA A . n A 1 25 PRO 25 45 45 PRO PRO A . n A 1 26 LEU 26 46 46 LEU LEU A . n A 1 27 GLN 27 47 47 GLN GLN A . n A 1 28 ILE 28 48 48 ILE ILE A . n A 1 29 ALA 29 49 49 ALA ALA A . n A 1 30 ASP 30 50 50 ASP ASP A . n A 1 31 HIS 31 51 51 HIS HIS A . n A 1 32 THR 32 52 52 THR THR A . n A 1 33 TRP 33 53 53 TRP TRP A . n A 1 34 GLN 34 54 54 GLN GLN A . n A 1 35 ILE 35 55 55 ILE ILE A . n A 1 36 GLY 36 56 56 GLY GLY A . n A 1 37 THR 37 57 57 THR THR A . n A 1 38 GLU 38 67 67 GLU GLU A . n A 1 39 ASP 39 68 68 ASP ASP A . n A 1 40 LEU 40 69 69 LEU LEU A . n A 1 41 THR 41 70 70 THR THR A . n A 1 42 ALA 42 71 71 ALA ALA A . n A 1 43 LEU 43 72 72 LEU LEU A . n A 1 44 LEU 44 73 73 LEU LEU A . n A 1 45 VAL 45 74 74 VAL VAL A . n A 1 46 GLN 46 75 75 GLN GLN A . n A 1 47 THR 47 76 76 THR THR A . n A 1 48 PRO 48 77 77 PRO PRO A . n A 1 49 ASP 49 78 78 ASP ASP A . n A 1 50 GLY 50 79 79 GLY GLY A . n A 1 51 ALA 51 80 80 ALA ALA A . n A 1 52 VAL 52 81 81 VAL VAL A . n A 1 53 LEU 53 82 82 LEU LEU A . n A 1 54 LEU 54 83 83 LEU LEU A . n A 1 55 ASP 55 84 84 ASP ASP A . n A 1 56 GLY 56 85 85 GLY GLY A . n A 1 57 GLY 57 86 86 GLY GLY A . n A 1 58 MET 58 87 87 MET MET A . n A 1 59 PRO 59 89 89 PRO PRO A . n A 1 60 GLN 60 90 90 GLN GLN A . n A 1 61 MET 61 91 91 MET MET A . n A 1 62 ALA 62 92 92 ALA ALA A . n A 1 63 SER 63 93 93 SER SER A . n A 1 64 HIS 64 94 94 HIS HIS A . n A 1 65 LEU 65 95 95 LEU LEU A . n A 1 66 LEU 66 96 96 LEU LEU A . n A 1 67 ASP 67 97 97 ASP ASP A . n A 1 68 ASN 68 98 98 ASN ASN A . n A 1 69 MET 69 99 99 MET MET A . n A 1 70 LYS 70 100 100 LYS LYS A . n A 1 71 ALA 71 101 101 ALA ALA A . n A 1 72 ARG 72 102 102 ARG ARG A . n A 1 73 GLY 73 103 103 GLY GLY A . n A 1 74 VAL 74 104 104 VAL VAL A . n A 1 75 THR 75 105 105 THR THR A . n A 1 76 PRO 76 106 106 PRO PRO A . n A 1 77 ARG 77 107 107 ARG ARG A . n A 1 78 ASP 78 108 108 ASP ASP A . n A 1 79 LEU 79 109 109 LEU LEU A . n A 1 80 ARG 80 110 110 ARG ARG A . n A 1 81 LEU 81 111 111 LEU LEU A . n A 1 82 ILE 82 112 112 ILE ILE A . n A 1 83 LEU 83 113 113 LEU LEU A . n A 1 84 LEU 84 114 114 LEU LEU A . n A 1 85 SER 85 115 115 SER SER A . n A 1 86 HIS 86 116 116 HIS HIS A . n A 1 87 ALA 87 117 117 ALA ALA A . n A 1 88 HIS 88 118 118 HIS HIS A . n A 1 89 ALA 89 119 119 ALA ALA A . n A 1 90 ASP 90 120 120 ASP ASP A . n A 1 91 HIS 91 121 121 HIS HIS A . n A 1 92 ALA 92 122 122 ALA ALA A . n A 1 93 GLY 93 123 123 GLY GLY A . n A 1 94 PRO 94 124 124 PRO PRO A . n A 1 95 VAL 95 125 125 VAL VAL A . n A 1 96 ALA 96 126 126 ALA ALA A . n A 1 97 GLU 97 127 127 GLU GLU A . n A 1 98 LEU 98 128 128 LEU LEU A . n A 1 99 LYS 99 129 129 LYS LYS A . n A 1 100 ARG 100 130 130 ARG ARG A . n A 1 101 ARG 101 131 131 ARG ARG A . n A 1 102 THR 102 132 132 THR THR A . n A 1 103 GLY 103 133 133 GLY GLY A . n A 1 104 ALA 104 134 134 ALA ALA A . n A 1 105 LYS 105 135 135 LYS LYS A . n A 1 106 VAL 106 136 136 VAL VAL A . n A 1 107 ALA 107 137 137 ALA ALA A . n A 1 108 ALA 108 138 138 ALA ALA A . n A 1 109 ASN 109 139 139 ASN ASN A . n A 1 110 ALA 110 140 140 ALA ALA A . n A 1 111 GLU 111 141 141 GLU GLU A . n A 1 112 SER 112 142 142 SER SER A . n A 1 113 ALA 113 143 143 ALA ALA A . n A 1 114 VAL 114 144 144 VAL VAL A . n A 1 115 LEU 115 145 145 LEU LEU A . n A 1 116 LEU 116 146 146 LEU LEU A . n A 1 117 ALA 117 147 147 ALA ALA A . n A 1 118 ARG 118 148 148 ARG ARG A . n A 1 119 GLY 119 149 149 GLY GLY A . n A 1 120 GLY 120 150 150 GLY GLY A . n A 1 121 SER 121 151 151 SER SER A . n A 1 122 ASP 122 152 152 ASP ASP A . n A 1 123 ASP 123 153 153 ASP ASP A . n A 1 124 LEU 124 154 154 LEU LEU A . n A 1 125 HIS 125 155 155 HIS HIS A . n A 1 126 PHE 126 156 156 PHE PHE A . n A 1 127 GLY 127 157 157 GLY GLY A . n A 1 128 ASP 128 160 160 ASP ASP A . n A 1 129 GLY 129 161 161 GLY GLY A . n A 1 130 ILE 130 162 162 ILE ILE A . n A 1 131 THR 131 163 163 THR THR A . n A 1 132 TYR 132 164 164 TYR TYR A . n A 1 133 PRO 133 165 165 PRO PRO A . n A 1 134 PRO 134 166 166 PRO PRO A . n A 1 135 ALA 135 168 168 ALA ALA A . n A 1 136 ASN 136 169 169 ASN ASN A . n A 1 137 ALA 137 170 170 ALA ALA A . n A 1 138 ASP 138 171 171 ASP ASP A . n A 1 139 ARG 139 172 172 ARG ARG A . n A 1 140 ILE 140 173 173 ILE ILE A . n A 1 141 VAL 141 174 174 VAL VAL A . n A 1 142 MET 142 175 175 MET MET A . n A 1 143 ASP 143 176 176 ASP ASP A . n A 1 144 GLY 144 177 177 GLY GLY A . n A 1 145 GLU 145 178 178 GLU GLU A . n A 1 146 VAL 146 179 179 VAL VAL A . n A 1 147 ILE 147 180 180 ILE ILE A . n A 1 148 THR 148 181 181 THR THR A . n A 1 149 VAL 149 182 182 VAL VAL A . n A 1 150 GLY 150 183 183 GLY GLY A . n A 1 151 GLY 151 184 184 GLY GLY A . n A 1 152 ILE 152 185 185 ILE ILE A . n A 1 153 VAL 153 186 186 VAL VAL A . n A 1 154 PHE 154 187 187 PHE PHE A . n A 1 155 THR 155 188 188 THR THR A . n A 1 156 ALA 156 189 189 ALA ALA A . n A 1 157 HIS 157 190 190 HIS HIS A . n A 1 158 PHE 158 191 191 PHE PHE A . n A 1 159 MET 159 193 193 MET MET A . n A 1 160 ALA 160 194 194 ALA ALA A . n A 1 161 GLY 161 195 195 GLY GLY A . n A 1 162 HIS 162 196 196 HIS HIS A . n A 1 163 THR 163 197 197 THR THR A . n A 1 164 PRO 164 198 198 PRO PRO A . n A 1 165 GLY 165 199 199 GLY GLY A . n A 1 166 SER 166 200 200 SER SER A . n A 1 167 THR 167 201 201 THR THR A . n A 1 168 ALA 168 202 202 ALA ALA A . n A 1 169 TRP 169 203 203 TRP TRP A . n A 1 170 THR 170 204 204 THR THR A . n A 1 171 TRP 171 205 205 TRP TRP A . n A 1 172 THR 172 206 206 THR THR A . n A 1 173 ASP 173 207 207 ASP ASP A . n A 1 174 THR 174 208 208 THR THR A . n A 1 175 ARG 175 209 209 ARG ARG A . n A 1 176 ASN 176 210 210 ASN ASN A . n A 1 177 GLY 177 211 211 GLY GLY A . n A 1 178 LYS 178 212 212 LYS LYS A . n A 1 179 PRO 179 213 213 PRO PRO A . n A 1 180 VAL 180 214 214 VAL VAL A . n A 1 181 ARG 181 215 215 ARG ARG A . n A 1 182 ILE 182 216 216 ILE ILE A . n A 1 183 ALA 183 217 217 ALA ALA A . n A 1 184 TYR 184 218 218 TYR TYR A . n A 1 185 ALA 185 219 219 ALA ALA A . n A 1 186 ASP 186 220 220 ASP ASP A . n A 1 187 SER 187 221 221 SER SER A . n A 1 188 LEU 188 222 222 LEU LEU A . n A 1 189 SER 189 225 225 SER SER A . n A 1 190 ALA 190 226 226 ALA ALA A . n A 1 191 PRO 191 227 227 PRO PRO A . n A 1 192 GLY 192 228 228 GLY GLY A . n A 1 193 TYR 193 229 229 TYR TYR A . n A 1 194 GLN 194 230 230 GLN GLN A . n A 1 195 LEU 195 231 231 LEU LEU A . n A 1 196 GLN 196 232 232 GLN GLN A . n A 1 197 GLY 197 233 233 GLY GLY A . n A 1 198 ASN 198 234 234 ASN ASN A . n A 1 199 PRO 199 235 235 PRO PRO A . n A 1 200 ARG 200 236 236 ARG ARG A . n A 1 201 TYR 201 237 237 TYR TYR A . n A 1 202 PRO 202 238 238 PRO PRO A . n A 1 203 HIS 203 239 239 HIS HIS A . n A 1 204 LEU 204 240 240 LEU LEU A . n A 1 205 ILE 205 241 241 ILE ILE A . n A 1 206 GLU 206 242 242 GLU GLU A . n A 1 207 ASP 207 243 243 ASP ASP A . n A 1 208 TYR 208 244 244 TYR TYR A . n A 1 209 ARG 209 245 245 ARG ARG A . n A 1 210 ARG 210 246 246 ARG ARG A . n A 1 211 SER 211 247 247 SER SER A . n A 1 212 PHE 212 248 248 PHE PHE A . n A 1 213 ALA 213 249 249 ALA ALA A . n A 1 214 THR 214 250 250 THR THR A . n A 1 215 VAL 215 251 251 VAL VAL A . n A 1 216 ARG 216 252 252 ARG ARG A . n A 1 217 ALA 217 253 253 ALA ALA A . n A 1 218 LEU 218 254 254 LEU LEU A . n A 1 219 PRO 219 255 255 PRO PRO A . n A 1 220 CYS 220 256 256 CYS CYS A . n A 1 221 ASP 221 257 257 ASP ASP A . n A 1 222 VAL 222 258 258 VAL VAL A . n A 1 223 LEU 223 259 259 LEU LEU A . n A 1 224 LEU 224 260 260 LEU LEU A . n A 1 225 THR 225 261 261 THR THR A . n A 1 226 PRO 226 262 262 PRO PRO A . n A 1 227 HIS 227 263 263 HIS HIS A . n A 1 228 PRO 228 264 264 PRO PRO A . n A 1 229 GLY 229 265 265 GLY GLY A . n A 1 230 ALA 230 266 266 ALA ALA A . n A 1 231 SER 231 267 267 SER SER A . n A 1 232 ASN 232 268 268 ASN ASN A . n A 1 233 TRP 233 269 269 TRP TRP A . n A 1 234 ASP 234 270 270 ASP ASP A . n A 1 235 TYR 235 271 271 TYR TYR A . n A 1 236 ALA 236 272 272 ALA ALA A . n A 1 237 ALA 237 273 273 ALA ALA A . n A 1 238 GLY 238 274 274 GLY GLY A . n A 1 239 ALA 239 275 275 ALA ALA A . n A 1 240 ARG 240 276 276 ARG ARG A . n A 1 241 ALA 241 289 289 ALA ALA A . n A 1 242 GLY 242 290 290 GLY GLY A . n A 1 243 ALA 243 291 291 ALA ALA A . n A 1 244 LYS 244 292 292 LYS LYS A . n A 1 245 ALA 245 293 293 ALA ALA A . n A 1 246 LEU 246 294 294 LEU LEU A . n A 1 247 THR 247 295 295 THR THR A . n A 1 248 CYS 248 296 296 CYS CYS A . n A 1 249 LYS 249 297 297 LYS LYS A . n A 1 250 ALA 250 298 298 ALA ALA A . n A 1 251 TYR 251 299 299 TYR TYR A . n A 1 252 ALA 252 300 300 ALA ALA A . n A 1 253 ASP 253 301 301 ASP ASP A . n A 1 254 ALA 254 302 302 ALA ALA A . n A 1 255 ALA 255 303 303 ALA ALA A . n A 1 256 GLU 256 304 304 GLU GLU A . n A 1 257 GLN 257 305 305 GLN GLN A . n A 1 258 LYS 258 306 306 LYS LYS A . n A 1 259 PHE 259 307 307 PHE PHE A . n A 1 260 ASP 260 308 308 ASP ASP A . n A 1 261 GLY 261 309 309 GLY GLY A . n A 1 262 GLN 262 310 310 GLN GLN A . n A 1 263 LEU 263 311 311 LEU LEU A . n A 1 264 ALA 264 312 312 ALA ALA A . n A 1 265 LYS 265 313 313 LYS LYS A . n A 1 266 GLU 266 314 314 GLU GLU A . n A 1 267 THR 267 315 315 THR THR A . n A 1 268 ALA 268 316 316 ALA ALA A . n A 1 269 GLY 269 317 317 GLY GLY A . n A 1 270 ALA 270 318 ? ? ? A . n A 1 271 ARG 271 319 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 VC2 1 401 318 VC2 VC2 A . C 3 ZN 1 402 1 ZN ZN A . D 3 ZN 1 403 2 ZN ZN A . E 4 SO4 1 404 1 SO4 SO4 A . F 4 SO4 1 405 2 SO4 SO4 A . G 5 HOH 1 501 63 HOH HOH A . G 5 HOH 2 502 109 HOH HOH A . G 5 HOH 3 503 59 HOH HOH A . G 5 HOH 4 504 183 HOH HOH A . G 5 HOH 5 505 264 HOH HOH A . G 5 HOH 6 506 190 HOH HOH A . G 5 HOH 7 507 71 HOH HOH A . G 5 HOH 8 508 55 HOH HOH A . G 5 HOH 9 509 201 HOH HOH A . G 5 HOH 10 510 57 HOH HOH A . G 5 HOH 11 511 79 HOH HOH A . G 5 HOH 12 512 152 HOH HOH A . G 5 HOH 13 513 52 HOH HOH A . G 5 HOH 14 514 247 HOH HOH A . G 5 HOH 15 515 99 HOH HOH A . G 5 HOH 16 516 20 HOH HOH A . G 5 HOH 17 517 141 HOH HOH A . G 5 HOH 18 518 128 HOH HOH A . G 5 HOH 19 519 83 HOH HOH A . G 5 HOH 20 520 165 HOH HOH A . G 5 HOH 21 521 237 HOH HOH A . G 5 HOH 22 522 11 HOH HOH A . G 5 HOH 23 523 58 HOH HOH A . G 5 HOH 24 524 65 HOH HOH A . G 5 HOH 25 525 77 HOH HOH A . G 5 HOH 26 526 207 HOH HOH A . G 5 HOH 27 527 26 HOH HOH A . G 5 HOH 28 528 23 HOH HOH A . G 5 HOH 29 529 232 HOH HOH A . G 5 HOH 30 530 139 HOH HOH A . G 5 HOH 31 531 76 HOH HOH A . G 5 HOH 32 532 275 HOH HOH A . G 5 HOH 33 533 9 HOH HOH A . G 5 HOH 34 534 34 HOH HOH A . G 5 HOH 35 535 87 HOH HOH A . G 5 HOH 36 536 226 HOH HOH A . G 5 HOH 37 537 214 HOH HOH A . G 5 HOH 38 538 291 HOH HOH A . G 5 HOH 39 539 2 HOH HOH A . G 5 HOH 40 540 80 HOH HOH A . G 5 HOH 41 541 142 HOH HOH A . G 5 HOH 42 542 114 HOH HOH A . G 5 HOH 43 543 30 HOH HOH A . G 5 HOH 44 544 74 HOH HOH A . G 5 HOH 45 545 159 HOH HOH A . G 5 HOH 46 546 10 HOH HOH A . G 5 HOH 47 547 168 HOH HOH A . G 5 HOH 48 548 98 HOH HOH A . G 5 HOH 49 549 64 HOH HOH A . G 5 HOH 50 550 75 HOH HOH A . G 5 HOH 51 551 133 HOH HOH A . G 5 HOH 52 552 28 HOH HOH A . G 5 HOH 53 553 248 HOH HOH A . G 5 HOH 54 554 116 HOH HOH A . G 5 HOH 55 555 14 HOH HOH A . G 5 HOH 56 556 135 HOH HOH A . G 5 HOH 57 557 13 HOH HOH A . G 5 HOH 58 558 256 HOH HOH A . G 5 HOH 59 559 21 HOH HOH A . G 5 HOH 60 560 8 HOH HOH A . G 5 HOH 61 561 62 HOH HOH A . G 5 HOH 62 562 85 HOH HOH A . G 5 HOH 63 563 187 HOH HOH A . G 5 HOH 64 564 134 HOH HOH A . G 5 HOH 65 565 53 HOH HOH A . G 5 HOH 66 566 138 HOH HOH A . G 5 HOH 67 567 92 HOH HOH A . G 5 HOH 68 568 36 HOH HOH A . G 5 HOH 69 569 6 HOH HOH A . G 5 HOH 70 570 1 HOH HOH A . G 5 HOH 71 571 32 HOH HOH A . G 5 HOH 72 572 19 HOH HOH A . G 5 HOH 73 573 174 HOH HOH A . G 5 HOH 74 574 102 HOH HOH A . G 5 HOH 75 575 101 HOH HOH A . G 5 HOH 76 576 7 HOH HOH A . G 5 HOH 77 577 186 HOH HOH A . G 5 HOH 78 578 104 HOH HOH A . G 5 HOH 79 579 35 HOH HOH A . G 5 HOH 80 580 37 HOH HOH A . G 5 HOH 81 581 148 HOH HOH A . G 5 HOH 82 582 51 HOH HOH A . G 5 HOH 83 583 15 HOH HOH A . G 5 HOH 84 584 241 HOH HOH A . G 5 HOH 85 585 125 HOH HOH A . G 5 HOH 86 586 91 HOH HOH A . G 5 HOH 87 587 220 HOH HOH A . G 5 HOH 88 588 33 HOH HOH A . G 5 HOH 89 589 108 HOH HOH A . G 5 HOH 90 590 82 HOH HOH A . G 5 HOH 91 591 103 HOH HOH A . G 5 HOH 92 592 38 HOH HOH A . G 5 HOH 93 593 122 HOH HOH A . G 5 HOH 94 594 100 HOH HOH A . G 5 HOH 95 595 3 HOH HOH A . G 5 HOH 96 596 281 HOH HOH A . G 5 HOH 97 597 210 HOH HOH A . G 5 HOH 98 598 73 HOH HOH A . G 5 HOH 99 599 68 HOH HOH A . G 5 HOH 100 600 27 HOH HOH A . G 5 HOH 101 601 218 HOH HOH A . G 5 HOH 102 602 44 HOH HOH A . G 5 HOH 103 603 171 HOH HOH A . G 5 HOH 104 604 189 HOH HOH A . G 5 HOH 105 605 184 HOH HOH A . G 5 HOH 106 606 119 HOH HOH A . G 5 HOH 107 607 12 HOH HOH A . G 5 HOH 108 608 161 HOH HOH A . G 5 HOH 109 609 105 HOH HOH A . G 5 HOH 110 610 95 HOH HOH A . G 5 HOH 111 611 70 HOH HOH A . G 5 HOH 112 612 17 HOH HOH A . G 5 HOH 113 613 97 HOH HOH A . G 5 HOH 114 614 150 HOH HOH A . G 5 HOH 115 615 94 HOH HOH A . G 5 HOH 116 616 126 HOH HOH A . G 5 HOH 117 617 50 HOH HOH A . G 5 HOH 118 618 89 HOH HOH A . G 5 HOH 119 619 78 HOH HOH A . G 5 HOH 120 620 46 HOH HOH A . G 5 HOH 121 621 267 HOH HOH A . G 5 HOH 122 622 279 HOH HOH A . G 5 HOH 123 623 22 HOH HOH A . G 5 HOH 124 624 272 HOH HOH A . G 5 HOH 125 625 47 HOH HOH A . G 5 HOH 126 626 31 HOH HOH A . G 5 HOH 127 627 173 HOH HOH A . G 5 HOH 128 628 224 HOH HOH A . G 5 HOH 129 629 230 HOH HOH A . G 5 HOH 130 630 18 HOH HOH A . G 5 HOH 131 631 200 HOH HOH A . G 5 HOH 132 632 255 HOH HOH A . G 5 HOH 133 633 265 HOH HOH A . G 5 HOH 134 634 72 HOH HOH A . G 5 HOH 135 635 151 HOH HOH A . G 5 HOH 136 636 61 HOH HOH A . G 5 HOH 137 637 45 HOH HOH A . G 5 HOH 138 638 110 HOH HOH A . G 5 HOH 139 639 56 HOH HOH A . G 5 HOH 140 640 176 HOH HOH A . G 5 HOH 141 641 5 HOH HOH A . G 5 HOH 142 642 140 HOH HOH A . G 5 HOH 143 643 66 HOH HOH A . G 5 HOH 144 644 147 HOH HOH A . G 5 HOH 145 645 290 HOH HOH A . G 5 HOH 146 646 111 HOH HOH A . G 5 HOH 147 647 4 HOH HOH A . G 5 HOH 148 648 115 HOH HOH A . G 5 HOH 149 649 25 HOH HOH A . G 5 HOH 150 650 249 HOH HOH A . G 5 HOH 151 651 145 HOH HOH A . G 5 HOH 152 652 29 HOH HOH A . G 5 HOH 153 653 127 HOH HOH A . G 5 HOH 154 654 236 HOH HOH A . G 5 HOH 155 655 245 HOH HOH A . G 5 HOH 156 656 40 HOH HOH A . G 5 HOH 157 657 170 HOH HOH A . G 5 HOH 158 658 84 HOH HOH A . G 5 HOH 159 659 81 HOH HOH A . G 5 HOH 160 660 163 HOH HOH A . G 5 HOH 161 661 107 HOH HOH A . G 5 HOH 162 662 86 HOH HOH A . G 5 HOH 163 663 266 HOH HOH A . G 5 HOH 164 664 156 HOH HOH A . G 5 HOH 165 665 60 HOH HOH A . G 5 HOH 166 666 39 HOH HOH A . G 5 HOH 167 667 204 HOH HOH A . G 5 HOH 168 668 42 HOH HOH A . G 5 HOH 169 669 182 HOH HOH A . G 5 HOH 170 670 48 HOH HOH A . G 5 HOH 171 671 253 HOH HOH A . G 5 HOH 172 672 219 HOH HOH A . G 5 HOH 173 673 41 HOH HOH A . G 5 HOH 174 674 131 HOH HOH A . G 5 HOH 175 675 120 HOH HOH A . G 5 HOH 176 676 194 HOH HOH A . G 5 HOH 177 677 90 HOH HOH A . G 5 HOH 178 678 16 HOH HOH A . G 5 HOH 179 679 274 HOH HOH A . G 5 HOH 180 680 132 HOH HOH A . G 5 HOH 181 681 143 HOH HOH A . G 5 HOH 182 682 262 HOH HOH A . G 5 HOH 183 683 43 HOH HOH A . G 5 HOH 184 684 123 HOH HOH A . G 5 HOH 185 685 234 HOH HOH A . G 5 HOH 186 686 93 HOH HOH A . G 5 HOH 187 687 261 HOH HOH A . G 5 HOH 188 688 158 HOH HOH A . G 5 HOH 189 689 231 HOH HOH A . G 5 HOH 190 690 88 HOH HOH A . G 5 HOH 191 691 153 HOH HOH A . G 5 HOH 192 692 195 HOH HOH A . G 5 HOH 193 693 287 HOH HOH A . G 5 HOH 194 694 69 HOH HOH A . G 5 HOH 195 695 258 HOH HOH A . G 5 HOH 196 696 121 HOH HOH A . G 5 HOH 197 697 286 HOH HOH A . G 5 HOH 198 698 288 HOH HOH A . G 5 HOH 199 699 284 HOH HOH A . G 5 HOH 200 700 223 HOH HOH A . G 5 HOH 201 701 178 HOH HOH A . G 5 HOH 202 702 269 HOH HOH A . G 5 HOH 203 703 24 HOH HOH A . G 5 HOH 204 704 235 HOH HOH A . G 5 HOH 205 705 162 HOH HOH A . G 5 HOH 206 706 289 HOH HOH A . G 5 HOH 207 707 239 HOH HOH A . G 5 HOH 208 708 260 HOH HOH A . G 5 HOH 209 709 155 HOH HOH A . G 5 HOH 210 710 254 HOH HOH A . G 5 HOH 211 711 172 HOH HOH A . G 5 HOH 212 712 202 HOH HOH A . G 5 HOH 213 713 49 HOH HOH A . G 5 HOH 214 714 211 HOH HOH A . G 5 HOH 215 715 113 HOH HOH A . G 5 HOH 216 716 217 HOH HOH A . G 5 HOH 217 717 280 HOH HOH A . G 5 HOH 218 718 243 HOH HOH A . G 5 HOH 219 719 212 HOH HOH A . G 5 HOH 220 720 259 HOH HOH A . G 5 HOH 221 721 67 HOH HOH A . G 5 HOH 222 722 228 HOH HOH A . G 5 HOH 223 723 193 HOH HOH A . G 5 HOH 224 724 263 HOH HOH A . G 5 HOH 225 725 175 HOH HOH A . G 5 HOH 226 726 118 HOH HOH A . G 5 HOH 227 727 167 HOH HOH A . G 5 HOH 228 728 271 HOH HOH A . G 5 HOH 229 729 268 HOH HOH A . G 5 HOH 230 730 146 HOH HOH A . G 5 HOH 231 731 188 HOH HOH A . G 5 HOH 232 732 242 HOH HOH A . G 5 HOH 233 733 196 HOH HOH A . G 5 HOH 234 734 137 HOH HOH A . G 5 HOH 235 735 215 HOH HOH A . G 5 HOH 236 736 96 HOH HOH A . G 5 HOH 237 737 149 HOH HOH A . G 5 HOH 238 738 198 HOH HOH A . G 5 HOH 239 739 130 HOH HOH A . G 5 HOH 240 740 144 HOH HOH A . G 5 HOH 241 741 164 HOH HOH A . G 5 HOH 242 742 221 HOH HOH A . G 5 HOH 243 743 252 HOH HOH A . G 5 HOH 244 744 216 HOH HOH A . G 5 HOH 245 745 191 HOH HOH A . G 5 HOH 246 746 276 HOH HOH A . G 5 HOH 247 747 278 HOH HOH A . G 5 HOH 248 748 192 HOH HOH A . G 5 HOH 249 749 213 HOH HOH A . G 5 HOH 250 750 283 HOH HOH A . G 5 HOH 251 751 292 HOH HOH A . G 5 HOH 252 752 154 HOH HOH A . G 5 HOH 253 753 227 HOH HOH A . G 5 HOH 254 754 169 HOH HOH A . G 5 HOH 255 755 180 HOH HOH A . G 5 HOH 256 756 166 HOH HOH A . G 5 HOH 257 757 157 HOH HOH A . G 5 HOH 258 758 179 HOH HOH A . G 5 HOH 259 759 117 HOH HOH A . G 5 HOH 260 760 206 HOH HOH A . G 5 HOH 261 761 244 HOH HOH A . G 5 HOH 262 762 251 HOH HOH A . G 5 HOH 263 763 112 HOH HOH A . G 5 HOH 264 764 160 HOH HOH A . G 5 HOH 265 765 185 HOH HOH A . G 5 HOH 266 766 177 HOH HOH A . G 5 HOH 267 767 285 HOH HOH A . G 5 HOH 268 768 124 HOH HOH A . G 5 HOH 269 769 197 HOH HOH A . G 5 HOH 270 770 205 HOH HOH A . G 5 HOH 271 771 54 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5EVD _cell.details ? _cell.formula_units_Z ? _cell.length_a 105.130 _cell.length_a_esd ? _cell.length_b 105.130 _cell.length_b_esd ? _cell.length_c 98.170 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5EVD _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5EVD _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.71 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM Hepes pH 7.75, 2.0 M ammonium sulphate, 1.5% PEG400. 1 ul protein (15 mg/ml) mixed with 1 ul reservoir.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-01-24 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5EVD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.80 _reflns.d_resolution_low 30.35 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 30208 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 33.8 _reflns.pdbx_Rmerge_I_obs 0.18 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.69 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.Rmerge_I_obs 0.858 _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.84 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_sigI_obs 4.29 _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_gt ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_gt ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_redundancy 34.9 _reflns_shell.pdbx_rejects ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_gt ? _reflns_shell.percent_possible_obs ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5EVD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.800 _refine.ls_d_res_low 30.348 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 30203 _refine.ls_number_reflns_R_free 1466 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.98 _refine.ls_percent_reflns_R_free 4.85 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1670 _refine.ls_R_factor_R_free 0.1957 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1655 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.43 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1SML _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 17.59 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.18 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2006 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 271 _refine_hist.number_atoms_total 2304 _refine_hist.d_res_high 1.800 _refine_hist.d_res_low 30.348 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 2091 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.048 ? 2860 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.596 ? 739 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.048 ? 317 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 375 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8000 1.8643 . . 158 2795 100.00 . . . 0.2550 . 0.2507 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8643 1.9390 . . 162 2792 100.00 . . . 0.2453 . 0.2161 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9390 2.0272 . . 122 2863 100.00 . . . 0.2326 . 0.1881 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0272 2.1341 . . 147 2808 100.00 . . . 0.2105 . 0.1833 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1341 2.2677 . . 119 2861 100.00 . . . 0.1922 . 0.1721 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2677 2.4427 . . 149 2858 100.00 . . . 0.2071 . 0.1692 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4427 2.6884 . . 158 2845 100.00 . . . 0.1982 . 0.1658 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6884 3.0771 . . 135 2895 100.00 . . . 0.1684 . 0.1644 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0771 3.8756 . . 150 2934 100.00 . . . 0.1775 . 0.1443 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8756 30.3527 . . 166 3086 100.00 . . . 0.1899 . 0.1499 . . . . . . . . . . # _struct.entry_id 5EVD _struct.title 'Crystal structure of the metallo-beta-lactamase L1 in complex with the bisthiazolidine inhibitor D-VC26' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5EVD _struct_keywords.text 'inhibitor, carbapenemase, antibiotic resistance, hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BLA1_STEMA _struct_ref.pdbx_db_accession P52700 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AEVPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLI LLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGH TPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGARAG AKALTCKAYADAAEQKFDGQLAKETAGAR ; _struct_ref.pdbx_align_begin 22 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5EVD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 271 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P52700 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 290 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 23 _struct_ref_seq.pdbx_auth_seq_align_end 319 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5EVD GLY A 1 ? UNP P52700 ? ? 'expression tag' 21 1 1 5EVD PRO A 2 ? UNP P52700 ? ? 'expression tag' 22 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.000000 0.000000 0.000000 0.00000 0.000000 1.000000 0.000000 0.00000 0.000000 0.000000 1.000000 0.00000 2 'point symmetry operation' ? ? -1.000000 0.000000 0.000000 -52.65000 0.000000 -1.000000 0.000000 91.19200 0.000000 0.000000 1.000000 0.00000 3 'point symmetry operation' ? ? 0.500000 0.866025 0.000000 -52.65000 0.866025 -0.500000 0.000000 91.19200 0.000000 0.000000 -1.000000 -32.69967 4 'point symmetry operation' ? ? -0.500000 -0.866025 0.000000 0.00000 -0.866025 0.500000 0.000000 0.00000 0.000000 0.000000 -1.000000 -32.69967 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 16 ? GLN A 21 ? ASP A 36 GLN A 41 5 ? 6 HELX_P HELX_P2 AA2 MET A 58 ? GLN A 60 ? MET A 87 GLN A 90 5 ? 3 HELX_P HELX_P3 AA3 MET A 61 ? ARG A 72 ? MET A 91 ARG A 102 1 ? 12 HELX_P HELX_P4 AA4 THR A 75 ? ARG A 77 ? THR A 105 ARG A 107 5 ? 3 HELX_P HELX_P5 AA5 HIS A 88 ? GLY A 93 ? HIS A 118 GLY A 123 1 ? 6 HELX_P HELX_P6 AA6 PRO A 94 ? THR A 102 ? PRO A 124 THR A 132 1 ? 9 HELX_P HELX_P7 AA7 ASN A 109 ? ARG A 118 ? ASN A 139 ARG A 148 1 ? 10 HELX_P HELX_P8 AA8 HIS A 203 ? LEU A 218 ? HIS A 239 LEU A 254 1 ? 16 HELX_P HELX_P9 AA9 HIS A 227 ? ASN A 232 ? HIS A 263 ASN A 268 5 ? 6 HELX_P HELX_P10 AB1 ASP A 234 ? ALA A 241 ? ASP A 270 ALA A 289 5 ? 8 HELX_P HELX_P11 AB2 THR A 247 ? GLY A 269 ? THR A 295 GLY A 317 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 220 SG ? ? ? 1_555 A CYS 248 SG ? ? A CYS 256 A CYS 296 1_555 ? ? ? ? ? ? ? 2.068 ? ? metalc1 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 116 A ZN 402 1_555 ? ? ? ? ? ? ? 2.117 ? ? metalc2 metalc ? ? A HIS 88 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 118 A ZN 402 1_555 ? ? ? ? ? ? ? 2.068 ? ? metalc3 metalc ? ? A ASP 90 OD2 ? ? ? 1_555 D ZN . ZN ? ? A ASP 120 A ZN 403 1_555 ? ? ? ? ? ? ? 2.012 ? ? metalc4 metalc ? ? A HIS 91 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 121 A ZN 403 1_555 ? ? ? ? ? ? ? 2.043 ? ? metalc5 metalc ? ? A HIS 162 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 196 A ZN 402 1_555 ? ? ? ? ? ? ? 2.074 ? ? metalc6 metalc ? ? A HIS 227 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 263 A ZN 403 1_555 ? ? ? ? ? ? ? 2.108 ? ? metalc7 metalc ? ? B VC2 . SAE ? ? ? 1_555 C ZN . ZN ? ? A VC2 401 A ZN 402 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc8 metalc ? ? B VC2 . SAE ? ? ? 1_555 D ZN . ZN ? ? A VC2 401 A ZN 403 1_555 ? ? ? ? ? ? ? 1.964 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 99.0 ? 2 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 97.0 ? 3 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 108.7 ? 4 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 112.0 ? 5 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 134.6 ? 6 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 99.8 ? 7 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 102.5 ? 8 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 99.9 ? 9 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 98.7 ? 10 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 108.7 ? 11 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 124.0 ? 12 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 119.5 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 220 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 248 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 256 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 296 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 26 ? ALA A 29 ? LEU A 46 ALA A 49 AA1 2 THR A 32 ? GLN A 34 ? THR A 52 GLN A 54 AA1 3 LEU A 43 ? THR A 47 ? LEU A 72 THR A 76 AA1 4 GLY A 50 ? LEU A 54 ? GLY A 79 LEU A 83 AA1 5 LEU A 79 ? LEU A 83 ? LEU A 109 LEU A 113 AA1 6 LYS A 105 ? ALA A 108 ? LYS A 135 ALA A 138 AA1 7 ARG A 139 ? ILE A 140 ? ARG A 172 ILE A 173 AA2 1 VAL A 146 ? VAL A 149 ? VAL A 179 VAL A 182 AA2 2 ILE A 152 ? PHE A 158 ? ILE A 185 PHE A 191 AA2 3 THR A 167 ? ARG A 175 ? THR A 201 ARG A 209 AA2 4 LYS A 178 ? TYR A 184 ? LYS A 212 TYR A 218 AA2 5 VAL A 222 ? LEU A 224 ? VAL A 258 LEU A 260 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 28 ? N ILE A 48 O THR A 32 ? O THR A 52 AA1 2 3 N TRP A 33 ? N TRP A 53 O LEU A 44 ? O LEU A 73 AA1 3 4 N VAL A 45 ? N VAL A 74 O VAL A 52 ? O VAL A 81 AA1 4 5 N LEU A 53 ? N LEU A 82 O LEU A 83 ? O LEU A 113 AA1 5 6 N ILE A 82 ? N ILE A 112 O LYS A 105 ? O LYS A 135 AA1 6 7 N ALA A 108 ? N ALA A 138 O ARG A 139 ? O ARG A 172 AA2 1 2 N ILE A 147 ? N ILE A 180 O PHE A 154 ? O PHE A 187 AA2 2 3 N HIS A 157 ? N HIS A 190 O ALA A 168 ? O ALA A 202 AA2 3 4 N ASP A 173 ? N ASP A 207 O VAL A 180 ? O VAL A 214 AA2 4 5 N ALA A 183 ? N ALA A 217 O VAL A 222 ? O VAL A 258 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A VC2 401 ? 14 'binding site for residue VC2 A 401' AC2 Software A ZN 402 ? 4 'binding site for residue ZN A 402' AC3 Software A ZN 403 ? 5 'binding site for residue ZN A 403' AC4 Software A SO4 404 ? 5 'binding site for residue SO4 A 404' AC5 Software A SO4 405 ? 8 'binding site for residue SO4 A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_idue SO4 A 404' AC5bx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 99.0 ? 2 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 97.0 ? 3 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 108.7 ? 4 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 112.0 ? 5 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 134.6 ? 6 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 99.8 ? 7 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 102.5 ? 8 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 99.9 ? 9 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 98.7 ? 10 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 108.7 ? 11 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 124.0 ? 12 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 119.5 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 220 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 248 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 256 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 296 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 26 ? ALA A 29 ? LEU A 46 ALA A 49 AA1 2 THR A 32 ? GLN A 34 ? THR A 52 GLN A 54 AA1 3 LEU A 43 ? THR A 47 ? LEU A 72 THR A 76 AA1 4 GLY A 50 ? LEU A 54 ? GLY A 79 LEU A 83 AA1 5 LEU A 79 ? LEU A 83 ? LEU A 109 LEU A 113 AA1 6 LYS A 105 ? ALA A 108 ? LYS A 135 ALA A 138 AA1 7 ARG A 139 ? ILE A 140 ? ARG A 172 ILE A 173 AA2 1 VAL A 146 ? VAL A 149 ? VAL A 179 VAL A 182 AA2 2 ILE A 152 ? PHE A 158 ? ILE A 185 PHE A 191 AA2 3 THR A 167 ? ARG A 175 ? THR A 201 ARG A 209 AA2 4 LYS A 178 ? TYR A 184 ? LYS A 212 TYR A 218 AA2 5 VAL A 222 ? LEU A 224 ? VAL A 258 LEU A 260 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 28 ? N ILE A 48 O THR A 32 ? O THR A 52 AA1 2 3 N TRP A 33 ? N TRP A 53 O LEU A 44 ? O LEU A 73 AA1 3 4 N VAL A 45 ? N VAL A 74 O VAL A 52 ? O VAL A 81 AA1 4 5 N LEU A 53 ? N LEU A 82 O LEU A 83 ? O LEU A 113 AA1 5 6 N ILE A 82 ? N ILE A 112 O LYS A 105 ? O LYS A 135 AA1 6 7 N ALA A 108 ? N ALA A 138 O ARG A 139 ? O ARG A 172 AA2 1 2 N ILE A 147 ? N ILE A 180 O PHE A 154 ? O PHE A 187 AA2 2 3 N HIS A 157 ? N HIS A 190 O ALA A 168 ? O ALA A 202 AA2 3 4 N ASP A 173 ? N ASP A 207 O VAL A 180 ? O VAL A 214 AA2 4 5 N ALA A 183 ? N ALA A 217 O VAL A 222 ? O VAL A 258 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A VC2 401 ? 14 'binding site for residue VC2 A 401' AC2 Software A ZN 402 ? 4 'binding site for residue ZN A 402' AC3 Software A ZN 403 ? 5 'binding site for residue ZN A 403' AC4 Software A SO4 404 ? 5 'binding site for residue SO4 A 404' AC5 Software A SO4 405 ? 8 'binding site for residue SO4 A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_idue SO4 A 404' AC5bx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 99.0 ? 2 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 97.0 ? 3 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 108.7 ? 4 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 112.0 ? 5 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 134.6 ? 6 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 99.8 ? 7 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 102.5 ? 8 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 99.9 ? 9 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 98.7 ? 10 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 108.7 ? 11 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 124.0 ? 12 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 119.5 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 220 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 248 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 256 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 296 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 26 ? ALA A 29 ? LEU A 46 ALA A 49 AA1 2 THR A 32 ? GLN A 34 ? THR A 52 GLN A 54 AA1 3 LEU A 43 ? THR A 47 ? LEU A 72 THR A 76 AA1 4 GLY A 50 ? LEU A 54 ? GLY A 79 LEU A 83 AA1 5 LEU A 79 ? LEU A 83 ? LEU A 109 LEU A 113 AA1 6 LYS A 105 ? ALA A 108 ? LYS A 135 ALA A 138 AA1 7 ARG A 139 ? ILE A 140 ? ARG A 172 ILE A 173 AA2 1 VAL A 146 ? VAL A 149 ? VAL A 179 VAL A 182 AA2 2 ILE A 152 ? PHE A 158 ? ILE A 185 PHE A 191 AA2 3 THR A 167 ? ARG A 175 ? THR A 201 ARG A 209 AA2 4 LYS A 178 ? TYR A 184 ? LYS A 212 TYR A 218 AA2 5 VAL A 222 ? LEU A 224 ? VAL A 258 LEU A 260 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 28 ? N ILE A 48 O THR A 32 ? O THR A 52 AA1 2 3 N TRP A 33 ? N TRP A 53 O LEU A 44 ? O LEU A 73 AA1 3 4 N VAL A 45 ? N VAL A 74 O VAL A 52 ? O VAL A 81 AA1 4 5 N LEU A 53 ? N LEU A 82 O LEU A 83 ? O LEU A 113 AA1 5 6 N ILE A 82 ? N ILE A 112 O LYS A 105 ? O LYS A 135 AA1 6 7 N ALA A 108 ? N ALA A 138 O ARG A 139 ? O ARG A 172 AA2 1 2 N ILE A 147 ? N ILE A 180 O PHE A 154 ? O PHE A 187 AA2 2 3 N HIS A 157 ? N HIS A 190 O ALA A 168 ? O ALA A 202 AA2 3 4 N ASP A 173 ? N ASP A 207 O VAL A 180 ? O VAL A 214 AA2 4 5 N ALA A 183 ? N ALA A 217 O VAL A 222 ? O VAL A 258 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A VC2 401 ? 14 'binding site for residue VC2 A 401' AC2 Software A ZN 402 ? 4 'binding site for residue ZN A 402' AC3 Software A ZN 403 ? 5 'binding site for residue ZN A 403' AC4 Software A SO4 404 ? 5 'binding site for residue SO4 A 404' AC5 Software A SO4 405 ? 8 'binding site for residue SO4 A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_idue SO4 A 404' AC5bx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 99.0 ? 2 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 97.0 ? 3 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 108.7 ? 4 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 112.0 ? 5 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 134.6 ? 6 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 99.8 ? 7 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 102.5 ? 8 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 99.9 ? 9 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 98.7 ? 10 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 108.7 ? 11 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 124.0 ? 12 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 119.5 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 220 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 248 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 256 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 296 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 26 ? ALA A 29 ? LEU A 46 ALA A 49 AA1 2 THR A 32 ? GLN A 34 ? THR A 52 GLN A 54 AA1 3 LEU A 43 ? THR A 47 ? LEU A 72 THR A 76 AA1 4 GLY A 50 ? LEU A 54 ? GLY A 79 LEU A 83 AA1 5 LEU A 79 ? LEU A 83 ? LEU A 109 LEU A 113 AA1 6 LYS A 105 ? ALA A 108 ? LYS A 135 ALA A 138 AA1 7 ARG A 139 ? ILE A 140 ? ARG A 172 ILE A 173 AA2 1 VAL A 146 ? VAL A 149 ? VAL A 179 VAL A 182 AA2 2 ILE A 152 ? PHE A 158 ? ILE A 185 PHE A 191 AA2 3 THR A 167 ? ARG A 175 ? THR A 201 ARG A 209 AA2 4 LYS A 178 ? TYR A 184 ? LYS A 212 TYR A 218 AA2 5 VAL A 222 ? LEU A 224 ? VAL A 258 LEU A 260 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 28 ? N ILE A 48 O THR A 32 ? O THR A 52 AA1 2 3 N TRP A 33 ? N TRP A 53 O LEU A 44 ? O LEU A 73 AA1 3 4 N VAL A 45 ? N VAL A 74 O VAL A 52 ? O VAL A 81 AA1 4 5 N LEU A 53 ? N LEU A 82 O LEU A 83 ? O LEU A 113 AA1 5 6 N ILE A 82 ? N ILE A 112 O LYS A 105 ? O LYS A 135 AA1 6 7 N ALA A 108 ? N ALA A 138 O ARG A 139 ? O ARG A 172 AA2 1 2 N ILE A 147 ? N ILE A 180 O PHE A 154 ? O PHE A 187 AA2 2 3 N HIS A 157 ? N HIS A 190 O ALA A 168 ? O ALA A 202 AA2 3 4 N ASP A 173 ? N ASP A 207 O VAL A 180 ? O VAL A 214 AA2 4 5 N ALA A 183 ? N ALA A 217 O VAL A 222 ? O VAL A 258 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A VC2 401 ? 14 'binding site for residue VC2 A 401' AC2 Software A ZN 402 ? 4 'binding site for residue ZN A 402' AC3 Software A ZN 403 ? 5 'binding site for residue ZN A 403' AC4 Software A SO4 404 ? 5 'binding site for residue SO4 A 404' AC5 Software A SO4 405 ? 8 'binding site for residue SO4 A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_idue SO4 A 404' AC5bx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 99.0 ? 2 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 97.0 ? 3 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 108.7 ? 4 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 112.0 ? 5 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 134.6 ? 6 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 99.8 ? 7 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 102.5 ? 8 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 99.9 ? 9 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 98.7 ? 10 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 108.7 ? 11 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 124.0 ? 12 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 119.5 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 220 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 248 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 256 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 296 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 26 ? ALA A 29 ? LEU A 46 ALA A 49 AA1 2 THR A 32 ? GLN A 34 ? THR A 52 GLN A 54 AA1 3 LEU A 43 ? THR A 47 ? LEU A 72 THR A 76 AA1 4 GLY A 50 ? LEU A 54 ? GLY A 79 LEU A 83 AA1 5 LEU A 79 ? LEU A 83 ? LEU A 109 LEU A 113 AA1 6 LYS A 105 ? ALA A 108 ? LYS A 135 ALA A 138 AA1 7 ARG A 139 ? ILE A 140 ? ARG A 172 ILE A 173 AA2 1 VAL A 146 ? VAL A 149 ? VAL A 179 VAL A 182 AA2 2 ILE A 152 ? PHE A 158 ? ILE A 185 PHE A 191 AA2 3 THR A 167 ? ARG A 175 ? THR A 201 ARG A 209 AA2 4 LYS A 178 ? TYR A 184 ? LYS A 212 TYR A 218 AA2 5 VAL A 222 ? LEU A 224 ? VAL A 258 LEU A 260 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 28 ? N ILE A 48 O THR A 32 ? O THR A 52 AA1 2 3 N TRP A 33 ? N TRP A 53 O LEU A 44 ? O LEU A 73 AA1 3 4 N VAL A 45 ? N VAL A 74 O VAL A 52 ? O VAL A 81 AA1 4 5 N LEU A 53 ? N LEU A 82 O LEU A 83 ? O LEU A 113 AA1 5 6 N ILE A 82 ? N ILE A 112 O LYS A 105 ? O LYS A 135 AA1 6 7 N ALA A 108 ? N ALA A 138 O ARG A 139 ? O ARG A 172 AA2 1 2 N ILE A 147 ? N ILE A 180 O PHE A 154 ? O PHE A 187 AA2 2 3 N HIS A 157 ? N HIS A 190 O ALA A 168 ? O ALA A 202 AA2 3 4 N ASP A 173 ? N ASP A 207 O VAL A 180 ? O VAL A 214 AA2 4 5 N ALA A 183 ? N ALA A 217 O VAL A 222 ? O VAL A 258 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A VC2 401 ? 14 'binding site for residue VC2 A 401' AC2 Software A ZN 402 ? 4 'binding site for residue ZN A 402' AC3 Software A ZN 403 ? 5 'binding site for residue ZN A 403' AC4 Software A SO4 404 ? 5 'binding site for residue SO4 A 404' AC5 Software A SO4 405 ? 8 'binding site for residue SO4 A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_idue SO4 A 404' AC5bx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 99.0 ? 2 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 97.0 ? 3 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 108.7 ? 4 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 112.0 ? 5 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 134.6 ? 6 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 99.8 ? 7 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 102.5 ? 8 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 99.9 ? 9 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 98.7 ? 10 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 108.7 ? 11 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 124.0 ? 12 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 119.5 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 220 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 248 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 256 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 296 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 26 ? ALA A 29 ? LEU A 46 ALA A 49 AA1 2 THR A 32 ? GLN A 34 ? THR A 52 GLN A 54 AA1 3 LEU A 43 ? THR A 47 ? LEU A 72 THR A 76 AA1 4 GLY A 50 ? LEU A 54 ? GLY A 79 LEU A 83 AA1 5 LEU A 79 ? LEU A 83 ? LEU A 109 LEU A 113 AA1 6 LYS A 105 ? ALA A 108 ? LYS A 135 ALA A 138 AA1 7 ARG A 139 ? ILE A 140 ? ARG A 172 ILE A 173 AA2 1 VAL A 146 ? VAL A 149 ? VAL A 179 VAL A 182 AA2 2 ILE A 152 ? PHE A 158 ? ILE A 185 PHE A 191 AA2 3 THR A 167 ? ARG A 175 ? THR A 201 ARG A 209 AA2 4 LYS A 178 ? TYR A 184 ? LYS A 212 TYR A 218 AA2 5 VAL A 222 ? LEU A 224 ? VAL A 258 LEU A 260 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 28 ? N ILE A 48 O THR A 32 ? O THR A 52 AA1 2 3 N TRP A 33 ? N TRP A 53 O LEU A 44 ? O LEU A 73 AA1 3 4 N VAL A 45 ? N VAL A 74 O VAL A 52 ? O VAL A 81 AA1 4 5 N LEU A 53 ? N LEU A 82 O LEU A 83 ? O LEU A 113 AA1 5 6 N ILE A 82 ? N ILE A 112 O LYS A 105 ? O LYS A 135 AA1 6 7 N ALA A 108 ? N ALA A 138 O ARG A 139 ? O ARG A 172 AA2 1 2 N ILE A 147 ? N ILE A 180 O PHE A 154 ? O PHE A 187 AA2 2 3 N HIS A 157 ? N HIS A 190 O ALA A 168 ? O ALA A 202 AA2 3 4 N ASP A 173 ? N ASP A 207 O VAL A 180 ? O VAL A 214 AA2 4 5 N ALA A 183 ? N ALA A 217 O VAL A 222 ? O VAL A 258 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A VC2 401 ? 14 'binding site for residue VC2 A 401' AC2 Software A ZN 402 ? 4 'binding site for residue ZN A 402' AC3 Software A ZN 403 ? 5 'binding site for residue ZN A 403' AC4 Software A SO4 404 ? 5 'binding site for residue SO4 A 404' AC5 Software A SO4 405 ? 8 'binding site for residue SO4 A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_idue SO4 A 404' AC5bx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 99.0 ? 2 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 97.0 ? 3 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 108.7 ? 4 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 112.0 ? 5 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 134.6 ? 6 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 99.8 ? 7 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 102.5 ? 8 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 99.9 ? 9 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 98.7 ? 10 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 108.7 ? 11 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 124.0 ? 12 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 119.5 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 220 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 248 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 256 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 296 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 26 ? ALA A 29 ? LEU A 46 ALA A 49 AA1 2 THR A 32 ? GLN A 34 ? THR A 52 GLN A 54 AA1 3 LEU A 43 ? THR A 47 ? LEU A 72 THR A 76 AA1 4 GLY A 50 ? LEU A 54 ? GLY A 79 LEU A 83 AA1 5 LEU A 79 ? LEU A 83 ? LEU A 109 LEU A 113 AA1 6 LYS A 105 ? ALA A 108 ? LYS A 135 ALA A 138 AA1 7 ARG A 139 ? ILE A 140 ? ARG A 172 ILE A 173 AA2 1 VAL A 146 ? VAL A 149 ? VAL A 179 VAL A 182 AA2 2 ILE A 152 ? PHE A 158 ? ILE A 185 PHE A 191 AA2 3 THR A 167 ? ARG A 175 ? THR A 201 ARG A 209 AA2 4 LYS A 178 ? TYR A 184 ? LYS A 212 TYR A 218 AA2 5 VAL A 222 ? LEU A 224 ? VAL A 258 LEU A 260 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 28 ? N ILE A 48 O THR A 32 ? O THR A 52 AA1 2 3 N TRP A 33 ? N TRP A 53 O LEU A 44 ? O LEU A 73 AA1 3 4 N VAL A 45 ? N VAL A 74 O VAL A 52 ? O VAL A 81 AA1 4 5 N LEU A 53 ? N LEU A 82 O LEU A 83 ? O LEU A 113 AA1 5 6 N ILE A 82 ? N ILE A 112 O LYS A 105 ? O LYS A 135 AA1 6 7 N ALA A 108 ? N ALA A 138 O ARG A 139 ? O ARG A 172 AA2 1 2 N ILE A 147 ? N ILE A 180 O PHE A 154 ? O PHE A 187 AA2 2 3 N HIS A 157 ? N HIS A 190 O ALA A 168 ? O ALA A 202 AA2 3 4 N ASP A 173 ? N ASP A 207 O VAL A 180 ? O VAL A 214 AA2 4 5 N ALA A 183 ? N ALA A 217 O VAL A 222 ? O VAL A 258 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A VC2 401 ? 14 'binding site for residue VC2 A 401' AC2 Software A ZN 402 ? 4 'binding site for residue ZN A 402' AC3 Software A ZN 403 ? 5 'binding site for residue ZN A 403' AC4 Software A SO4 404 ? 5 'binding site for residue SO4 A 404' AC5 Software A SO4 405 ? 8 'binding site for residue SO4 A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_idue SO4 A 404' AC5bx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 99.0 ? 2 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 97.0 ? 3 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 108.7 ? 4 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 112.0 ? 5 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 134.6 ? 6 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 99.8 ? 7 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 102.5 ? 8 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 99.9 ? 9 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 98.7 ? 10 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 108.7 ? 11 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 124.0 ? 12 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 119.5 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 220 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 248 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 256 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 296 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 26 ? ALA A 29 ? LEU A 46 ALA A 49 AA1 2 THR A 32 ? GLN A 34 ? THR A 52 GLN A 54 AA1 3 LEU A 43 ? THR A 47 ? LEU A 72 THR A 76 AA1 4 GLY A 50 ? LEU A 54 ? GLY A 79 LEU A 83 AA1 5 LEU A 79 ? LEU A 83 ? LEU A 109 LEU A 113 AA1 6 LYS A 105 ? ALA A 108 ? LYS A 135 ALA A 138 AA1 7 ARG A 139 ? ILE A 140 ? ARG A 172 ILE A 173 AA2 1 VAL A 146 ? VAL A 149 ? VAL A 179 VAL A 182 AA2 2 ILE A 152 ? PHE A 158 ? ILE A 185 PHE A 191 AA2 3 THR A 167 ? ARG A 175 ? THR A 201 ARG A 209 AA2 4 LYS A 178 ? TYR A 184 ? LYS A 212 TYR A 218 AA2 5 VAL A 222 ? LEU A 224 ? VAL A 258 LEU A 260 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 28 ? N ILE A 48 O THR A 32 ? O THR A 52 AA1 2 3 N TRP A 33 ? N TRP A 53 O LEU A 44 ? O LEU A 73 AA1 3 4 N VAL A 45 ? N VAL A 74 O VAL A 52 ? O VAL A 81 AA1 4 5 N LEU A 53 ? N LEU A 82 O LEU A 83 ? O LEU A 113 AA1 5 6 N ILE A 82 ? N ILE A 112 O LYS A 105 ? O LYS A 135 AA1 6 7 N ALA A 108 ? N ALA A 138 O ARG A 139 ? O ARG A 172 AA2 1 2 N ILE A 147 ? N ILE A 180 O PHE A 154 ? O PHE A 187 AA2 2 3 N HIS A 157 ? N HIS A 190 O ALA A 168 ? O ALA A 202 AA2 3 4 N ASP A 173 ? N ASP A 207 O VAL A 180 ? O VAL A 214 AA2 4 5 N ALA A 183 ? N ALA A 217 O VAL A 222 ? O VAL A 258 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A VC2 401 ? 14 'binding site for residue VC2 A 401' AC2 Software A ZN 402 ? 4 'binding site for residue ZN A 402' AC3 Software A ZN 403 ? 5 'binding site for residue ZN A 403' AC4 Software A SO4 404 ? 5 'binding site for residue SO4 A 404' AC5 Software A SO4 405 ? 8 'binding site for residue SO4 A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_idue SO4 A 404' AC5bx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 99.0 ? 2 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 97.0 ? 3 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 108.7 ? 4 NE2 ? A HIS 86 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 112.0 ? 5 ND1 ? A HIS 88 ? A HIS 118 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 134.6 ? 6 NE2 ? A HIS 162 ? A HIS 196 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 99.8 ? 7 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 102.5 ? 8 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 99.9 ? 9 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 98.7 ? 10 OD2 ? A ASP 90 ? A ASP 120 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 108.7 ? 11 NE2 ? A HIS 91 ? A HIS 121 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 124.0 ? 12 NE2 ? A HIS 227 ? A HIS 263 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SAE ? B VC2 . ? A VC2 401 ? 1_555 119.5 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 220 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 248 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 256 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 296 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 26 ? ALA A 29 ? LEU A 46 ALA A 49 AA1 2 THR A 32 ? GLN A 34 ? THR A 52 GLN A 54 AA1 3 LEU A 43 ? THR A 47 ? LEU A 72 THR A 76 AA1 4 GLY A 50 ? LEU A 54 ? GLY A 79 LEU A 83 AA1 5 LEU A 79 ? LEU A 83 ? LEU A 109 LEU A 113 AA1 6 LYS A 105 ? ALA A 108 ? LYS A 135 ALA A 138 AA1 7 ARG A 139 ? ILE A 140 ? ARG A 172 ILE A 173 AA2 1 VAL A 146 ? VAL A 149 ? VAL A 179 VAL A 182 AA2 2 ILE A 152 ? PHE A 158 ? ILE A 185 PHE A 191 AA2 3 THR A 167 ? ARG A 175 ? THR A 201 ARG A 209 AA2 4 LYS A 178 ? TYR A 184 ? LYS A 212 TYR A 218 AA2 5 VAL A 222 ? LEU A 224 ? VAL A 258 LEU A 260 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 28 ? N ILE A 48 O THR A 32 ? O THR A 52 AA1 2 3 N TRP A 33 ? N TRP A 53 O LEU A 44 ? O LEU A 73 AA1 3 4 N VAL A 45 ? N VAL A 74 O VAL A 52 ? O VAL A 81 AA1 4 5 N LEU A 53 ? N LEU A 82 O LEU A 83 ? O LEU A 113 AA1 5 6 N ILE A 82 ? N ILE A 112 O LYS A 105 ? O LYS A 135 AA1 6 7 N ALA A 108 ? N ALA A 138 O ARG A 139 ? O ARG A 172 AA2 1 2 N ILE A 147 ? N ILE A 180 O PHE A 154 ? O PHE A 187 AA2 2 3 N HIS A 157 ? N HIS A 190 O ALA A 168 ? O ALA A 202 AA2 3 4 N ASP A 173 ? N ASP A 207 O VAL A 180 ? O VAL A 214 AA2 4 5 N ALA A 183 ? N ALA A 217 O VAL A 222 ? O VAL A 258 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A VC2 401 ? 14 'binding site for residue VC2 A 401' AC2 Software A ZN 402 ? 4 'binding site for residue ZN A 402' AC3 Software A ZN 403 ? 5 'binding site for residue ZN A 403' AC4 Software A SO4 404 ? 5 'binding site for residue SO4 A 404' AC5 Software A SO4 405 ? 8 'binding site for residue SO4 A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_idue SO4 A 404' AC5bx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr237-08id con4MHq_id _pdbx_struct_cocode _pdbxHdbxHdbxHdbxHdbxHdb.ocode r2_label_seqnr2_auth_cpdbx_modification_feature_site_gv _st5p_id 3.fication_featu# loop_ _pdbx_struct_p 6dification_feature_site_gv _st5p_i1_555 ZN ? C ZN0icatiostruct_e_hp_i3e.modifnge.beg_labe0 9con4 422ul4Gge_2_label_atom_id _atom_i3.ostruct_e_hp_ir r4xmp_ide.ep_ir2_PDB_ih _m_i3.ostruct_e_hp_ir r7 s? A ZN 403'3r r7 BS7 ZN ? DGth_seq_id _struct_sie_ir r7 s? A ZN uctir2_PZN ? u_res _struct_e.ptn_pdbx_s r2_la_conn_anQ_pdbxHeq_id _struE _struc _struct_e.pt _p_i1_9ZN ? u_res _strct_e.pt _p7tware A ZN 402 ? 4 ruc _stru 139 ? O ARG A 172 As.fi _stru 139 R errsheet_id _snn_angle.ptnrlite for residue ZN A e_1_auth_ir r7 s? A ZN 403e.b_seq_id 220 _pdbx_modificbond6m3te_gen.label_comp_id 6sidue ZN? 1_555 C ZN0icatiostruct_acv1 AA2xmpins_ ZN0n . L88 21ite for residu2ebx_auth_ins_o ZN0icatiosS ZN0icatiosdu2ebx_aut 1Ires _struct2 . ? A ZN 402 ? 1um_res _structh_ins_o Zmodification_feature3nnond.range_2_auth_seq_iebx_aut 1Ires _struct2 . ? A ZN 402 ? 1uFGA ZN 402 ? 1uFGA odifit_sheet_or_2_auth_co ZN uctir2_PZN ? ue_2_auth_seq_. LEtruct_sheet_hsheet_or_2_aEnr2_l_hbond.range_2_PDB_ins_code _pdbx_struc2_auth_seA 109 Lh_seq_. LEtruct_sheet_hshee0icatiostruct_acv_l_hbo-nu 13s PHE 8nr2_auth_asym_id _pdbx_strucnr2_auth_ascatiostruct_acv_l_hb GLYth_hboure.modified_id _struct_site_gen.site_id u2d _pdbx_strucruct_sheet_hbond.range_1_auth_comp_id __pdbx_struct_sheet_hbond.ran N ILE A 48 Oe5p_id 3ct_si2.range_0Roe__pdbx_struct_sheet_hbT ZN 403e.b_s2COe5p_id 38d _dbx_strdYsp_id ge_2_lab133ct_fication_feature.type e e2ion_feature.ty43dy43dy427 ? A HIS 263A ASP 90 ? A ASP 120 ? 1_555H.LxIatomsIS 263A ASP 90 ? A A4 263A ASP 133ct_ficati6scatiostruct_acv_l_hb GLYth_hbcati6scatiostruct_aIS 263A ASP 90 ? A ASP 12bbcati6scatiostruct_a1 ASPr_a1 ASPe? A HIS . ? A ZN 402 ? 1um_res_res_reeCOe5HiO3dy42ct_siication_featuDh_asym_imberM6Ed _struct_sheet_range. ZN .dbx_struct_conn_angle.ptnr3_auth_atom_id 4RllabHR A 52 AA1 2 3 N Tidue ZN A 40pw'gle.ptn.1_555 Zct_t_sIS A 190 O ALA A A A A A A ANHR A 52 AAlr3_auth_atom_id 4Rlla4e for residue SO4 A 405' # S _pdbx_modifitA ZN5ostruct_acv_lhstruct_'_modifitA ZN5ostLE A 48 Oe5p_13s cv_lhstru 296 _pdbx_ruct_sheetbCOe5HRbCOueRc2IP5HRbCOueRc2IP5HRbCOueRc2AA1 Oe5p_13s3?ALA A 183 ?p_id _struc83 9 NE2 ? A NE2_str_featuDh_asym_2AA1 K5HRbCOueRc2AA1 Oe5p_13s3?ALA A 183 ?oh_attr_featuDh_asym_283 ?oh_attrabel ASP 90 IP5HRbCOues_sym_id _struct_site_2pdbx_struct_o3,_ge68 ? O ALA A 202 AA2 LYthACOueRc2AA1 Oe5p_13s3?ALA A 1u0 A 202 AA2 LYthACOueRc2AA1 Huct AA1 ege68 ? O ALA A 202 AA2 LYthACOueRc2AA1 Oe5 ? 3_as _conn_angle.ptnr3_auth_atol5 'binding site for rsite for rsite 2t_hbond.range_1_auth_seq_bx_strucruct_7 2 3 N Tidue Z.site_iptrucr7 # loop_ _struct_sitstruct_sitstruc2truct_acing site for rese_id5_res _strct_e.pt _p7TC2rese_id5_res _strct_e.pt _p74Gruct_site_gen.label_asn.label_asn.lab3-08id con4MHq_id _pdbx_sd5_res _strct_e.pt _p7TC2rd _p_res _str6u5 C ZN0icaTe LYthACOueRc2AA1 Oe5p_13ct_sitstruct_sitstruc2trucHodif _p7TC2rd _p_res _str6u68Te Lg_label_comp_A 190 O ALA A A A A A A ANHR A 52 AAlr3_auth_at9id _pdres ruct_acing site for rep7nd6m3te_gen.label_comp_id 6sidue ZN? 1_555 C 5 ? N VAL A 5_resL 'Disulfide brct_e.pt _p7TC2rese_id5_res _strct_e.pt sd5_res _stn.label_asn.label_asn.r6u5 C ZN0icaTe LYthACOueRc2AAp74_id _stn.label_asn?3S _stn.label_asn?3S r1range.beg_authc2AAp74_id p2E A 191 AA2 3 THR A 167 ? ARG A 175 suct_conn_anglm89rNstrct_e.pt sd5_pdbx_strR6fitA ZN5ostLE A 48 Oe5p_13s c3s c3s c3s c3s0icaTe LYthACOueRc2AAp72pdbx_st0el AA1 3c_l AA1 3c_l Ath_seq_id uP2_idx_sing_atom Sidx_sin3tnd6m3te_gen.label_comp_id 6s1 3c_PTC loop_ _struct_site.id _Z8sidue ZN A 402' AC3 Sof Sof Sof Sof Sof Sof SA 175mp_id Sof Sof Sof So6_aut 1IresAC3 Sof Sof Sof Sof Sof Sof Sof Sof Sof dificatiuO6eatuDh_asym_283 ?oh_attrabel ASP 9atiuO6eatuDres _str6u5 C ZN0icaTe Lce3_struc2_auth_seA_pdbx_stru3_struct_site.id _struct_b1 3cG1 3c_l AA1 3c_l Ath_seq8i3cG1 3c AA1 3c_l Atf Suth_at9id _pdres ruct_a8? LYS A 212 TYR A 218 AA2 5 VAL A res _str6u68Te Lg_label_comp_A 3c So6_aut 1IresAC3 Sof Sof Soet_hbond.raYst0ep_A 3c So6_aa 3c So6_aut 1IresAC3 Sof So6_aut 0g1IresAC_pdbx_st5p_id 3ct_si2.range_6 3ct_si2.range_6 3ct_si2.ranCOue _asn.lab3-08id con4MHq_id Sof So6_aut 0g1IresAC_pdbx_st5uDres _str68nd.range_1_label_asym_id _pdbx_str2AAp74_id _stn.l_idet_id t0e 214 AA2 4 1_555 ZYR A81_PDB_ins_code _pdbx_struct_sheet_ p2E A 191 AA2 3 THR A 167 _A t0e 214 AA2 4 1_555 ZCnstruct_sitstSof Sofgx_beg_PDB_ins_code _struct_sheet_range.en55meg t0e 214 AA2.555 0_aIS 263AA1_hbond.range_1_label.r6u5 C ZN0icaTe LYthACOueRc2ASe AA2nCOue _asn.lab3- anti-paO2Sl3dbx_0e _asn.lab3- anti-paO2Sl3Y0e _a8VE2Sl3Y0e _a8VE2Sl3YPDB_ins_codge. ZN h56U h56S ? LEdbx CYS _pdbx_modification_fN h56U h56S ?9 for rsite 2t_hbon,e_id 4Rlla4e for residue SO4 A 405' #9 h56S ? LEdbx CYS _pdbx_mod7HtU_A t0e 214 ? 3_as _cox_mod7HtU_la4e for re2? 3_as _cox_mod7HtU_mp_id Sof Sof ion_fN hnbx 63 ZN0icaTe LYthACOueRc2ASe AA2nCOue _a36anti-paO2Sl3dbx_0e _asn.lab3- anti-paO2Sl3Y0e _a8VE2Sl3Z t0e 214 ?0HRbCOueRc2AA1 Oe3Z t0e 214 ?0HRbCOu3i5l3Yr rsite 2t_hbon,e_id 4Rlla4e for residue SO4 A 40ihFe4p_13s c3s c3s c3s c3s0_hbond.range_2_label_asym_id ucru5_id 43C2rese_id5_res _S .id _struct_sheet_bel_F'LE A 48 O THR A 32 ? O THR A 52 AA1i5cox_mo3 r1range.beange_de_1_labe5thACOueRc2ASe AA2nCOu AA1i5cox_LYS A 178 ? TYR A 18at9id _pdres 5f Sof ion_fN hnbx 665.ct_sheet_bel_Fid ? _pdbx__shdbx__sh AA1 3c_l Ath_seq_r7 # loop_ _stheet_becid _pdbx_struct_con hnbx 665.ct8665.ct8665.ct8665.ct8630RAsh AA1 3c_l Ath_seq_d Sof SuctifZct_t_sa A 81 AA1 4 3c_l AA1 3c_lsb_l AA1 3c_lsb_l _id _pdbx_str3of SoQtrucid odi- e e2A 190 O ALA 6 So6_aut 1Ires9 1IrL7ruct e2A 190 O ALA 6 Soct e2A 190 O AL 214_bel9THR A2d_label_comp_id _pdbx_struct_conn_angle _pdbx_struct_conn_angle _pd ? ,eh3angle _pdbx_struct_coSoct e2A 190 O 2t_site_2pdbx_modif _stT754m 5krN 5kr72g665.ct8angA 6 So6_aut r1rangestruct_Todbx_modificatir 402h0, 4Rlla4e for 6 So6_autbeg_auth5Z7autbeg_auLvrSo6_autbeg_auth5Z7autbeg_dbx__sh AA1 3c_l Ath_seq_r7 # h5Z7autbeg_auLvrSo6_A1 1 3c_l 6rSo6_A1 1 3ctA HI _struct_sheet_hbond.range_HI 8 e2A 1o AA1 5 n.site_id _struct_sit2eh3angle _pdbeg_auuct_sheet_hb1uct_con hnbxaS 263 s? A ZN 403e.b_seq_id 3 s.pdbx_evidenW3eet_hb1uct_con hnbxa7P92due_aT75tru5res _strct_ee1 A HIS 88 ? As9odi- e_aut_Ect_ee1 A HIS THR A 76 AA1 4 GLY A 50 ?t_Ee.pbXd ? ,eh3D1 ? A2E. i0-paO2Sl3dbx_eq_id Veet_id _pdbx_strucXASP bx_stru9kr72g665.ct8an AA1 3c_lsb_l 2A 190 O ALA 6 So6_aut 1IrA1 3 76 AA1 4Khbond.raYst0ep_A 3c So6_aa urOs _str23 76 AA1 47S 1 A HIS 88 ? As9odi- p _struc A 108s0e res _str6u68bx_struct_site.pdbx_auth_cu3 76 AA1 6 _cox_mod7Htt 1IresAC3 Sof Sof Soet_hbond.raYsRh HI _struOite.pdbx_auth_cu3 76 Gth_s6 AA1 6 _cox_mod7Hod7Hod7de.N _str23 76 Rh HI _struOitrucp6 _cox_p34cru5_id 43C2r0 6s0_hbond.ran'_s6 AA1 6 CYS _pdbx__modification_feature.mo1eq_id AA1 1 LEU A 26 ? ALA A O8 conmodifi8EU A bx_stru uc A 108s0e res _str65aut h5' CYS _pdbx__m_ 3 4el_difbx_stru uc A 108s0e rRllepdbx__modification_feustn.label0_m_ 3r857 ?v3Y0e _a8VED5label_comp_iS_struct_ 3r857 ?v3Y0e _a8VED5label_comp_iS_struceY0e _a8VED5label_comp_iSS_struct_ 3r2Enge_id_8 ? TYR A 18at9id _pdres 5f5id _pdres 5f5id _5f5id _f5id _f5id _f5id _f5i 3 s.pdbx_evidenW3eet_hb1uct_nd.rt23ruct_sheet_hbond.range_1_auth_comp_id _pdbx_stS1uct3Y0e _a8VED5label_cO8eT865bon,DMdbx_1Aabel_cO8eTe foG8bond.trang7hi5- anDM4cru-bel_atom_id _pdbx_struct_sheet_hbond.range_1bond.range_el_cO8eTe foG Sof Sofhb1uct_n'eSof ion5M rRlff Sof ion_fN l_cO8eTe foGHIS 254t4E A 79 ? LEU A 83 ?kfoGHIS 254Df5i 3 s.pdrt_hbond.raYsRh HI _sto s._a8VED5label_compMs._a8VED8QED556H652Sl3'6E1a8VED8QED556H6o63'6E1a8VED8QED556H6o63'6E1a8VED8QED5SG _pdbx_modification_feature.modifin_feature.modified_residue_labion_featurs3ere.modified_residue_le_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2 A 83 ? LEU A 109 LEU A 1ct_1ct_1ct_1ct_1 A 139e8 ? A O8 ? A109 LEU omp_id _pG Oe5p_13s3?ALA A 183 ?oh_attx_str2AAp74_A 43 ? THR A 47 ? LEU A 78 _atom1hTi- Vd _struct_s7uO2.?ct_conn_ang3_atom_id _px 665.ct86Yst0ep_A 3strut_at1 3ctm1hTi- 3 37 AA2 2 3 N3' N3' N3' N3'1id _pG Oe5p_13s3?ALA A 18aut6 ? 6 looB 50 ? LEU3 37 AAapdbx_auth_asym_id _strucpdbx__r4U A 83 AA1 5_8Mg3_atom_id N . ? A ZN 402 ? 1_555 NE2 r857 857 857 857 8. ? A .ptnr2_label_seq_id _pdbx_struct_conn_angliostruct_acv12 AA2nCOd7Htt ? LEU ? LEU3 ? A HIS 162 ? A HIS 196 ? ct_sh4nA HISY8? LEU Za6 p_i LEU32nA HISY8? LEU Za6 p_iZN ? C ZN . ? A ZN 402 ? 1_3 s67ISY8? LEU Za6 p_i LEU32h3i51_sheet_range.enTloop3el0_m_ dbx_auth_cu3 76 Gth_s6 402 ? e 76 Gth_s6 402 ? e 76 Gth_s6 402 ?1_shr1ranges6 ? ct_4 ? 6 looB 50 ? LEU3 3 LEtruct_she2f5id _pdres 5f5id _55id _pdres 5fstr65aut h5' CYS _pdbx__m_ 3 4el_difbx_sdif94id _pdres 5f5id _55id _pdres 5fstr65au Sof ion ? ,eh3D1 ? A2E. O4 NE2 ? A HIS 91 ? ? LEU8 ? LEU8_ ? LEU8? ,eh3D1 End.m_ 8]g665.O13End.mF_stru_labion_7uth_a2yE 4el_dir 8]g665.O13End.mF_stru_labion_7uthGO13End.mF_stru_labion3_atom_id N . ? A3 5aut h5' CY. ? A3 id N LEU A 53 ? d_reSCOd7Htt M2Huct_c 402 ?1_shr1o.mF_stru_labion3_atom_id N . 5' # loop_ _struct_si_ ? LEU8? ,eh3ft0ep_A 3c So6_aa uth_cuuth O4 NE2 ? A HIS 91A_pdbx_modification_feature.label_alt_id ? _pdbx_modificati,A 109 LEU A th_cu3 76 Gth_s6 AA1 A th_cu3 76 Gth_us6 AA1 A th_cu3 76 Gti61lNu_laS 227 ?ti61lNu_laS 22555 C 5 ? N1m_id N . 5'cbion_he2f5id _d _d 4cru5_id 4cru5_3idbx_mod 139e8t8e A ZN 402 ? 1_555 NE2 r8514t M2Huct_c 402 ?1_Huct_c 402 ?9(0mp_icad.ran8 ? LYS Ant8e A ZN 4028 ZN 4028 ZN 40Tuh3ft0e3Ae A ZN 4028 ZN 4028 ZN 40Tuh3A 108sTuh3ft0e3Ae A ZN 4028 ZN 4028 ZN 40Tuh3A 108sTuh3ft0e3Ae x_struct_sheet_hbondatom_icati6scatiostruct_a ? A ZN 402 ? 6 (6r9t8e A ZN 402r7 # h5Z7ti6scatiostruct_a ? A ZN 402 OS.05555 NE2 r8514t M2Huct_c6DM.OF6_sheet_hbond.range_1_auth_asymcu3 18a N .8rO4cru5_id 4cru5_3idbx_mod 139e8t8e A ZN 4Oe5p_13s3T33i_555 NE2 r85el_pdbx3 _dbx_struct_sh5Tdbx_auth_cu3 76 AA1 6 _cox_mod7Htt 1IresAC3 5u857 ?v3Y0e _a8VED5la_cox_mod7Htt 1IresAiTuh3A 108sTuA 108sT7th_atom_id _pdbx_struct_56bion_7uth_a2yE 4el_dir 8]g665.d_asym_id sym_id sym_id sym_id sym_id sym_id sym_iHp_i LEU32nbeg_dbx__sh AA1 pdbx_struct_56bion_7uth_a2V3021cati6sca5oTOUym_id sym_id 43C2r0A A 18au loo_ido_i432nbeg_dbx__auth_atom_id _pdbx_stB2oEU A 53 ? d_reSCOd7Htt M2Huct_c 402bx_struct_coHZN 4Oec 402bx_struct_coHZN 4Oec 402bx_sbx_sbx_? LEU3 _pG2bx_sdinB 5T d_reSCOd7Htt M2Huct_d 17G2bx_sdinB 5T d_reSCOT33i_555 NE2 r85el_pdbx3 _dbSr7TC2rd _p_res _str6u5 C ZN0icaTe LYthACOueRca7resym_iodification HI _struOiteSeel_,857 857 8. ? A .ptnr2_label_seq_id _8bindi3t_id 261atioation_feustn.label0_m_ 3r8YstruOiteSeel_,857 857 8. ? A ._pdbx_struct_conn_angle.ptnr2_auth_comp_id ding site for residue SO4 A 4092Sr85el_pdbx3 _dbSr7TC2rd 9Nptnr2_auth_comp_ptnr2_auth_comp_ptnr2_auth_3PZ2_auth_comp_id ding site for autOnr2_ Ar2_au_comp_struct_co3PZ2r2_auth_cotruOiteSeel_,857 857 8H? 1Z2r2_auth_cotB2oEU A 53 L?Fl_asym_oR-Z6ite_gen.site_id 1teSAi_55id _pn3_atom_id N . ? A3 5aut h5' CY. o9p_A 3c So6__A 3c So6__A Y6m_id _struct_si1A_atom_id N . ? A3 L57 ? N Hid N . ? A3 L57 ? N Hid N . ? Ax_strucHid2 r857 857 857 857 8. ? A .ptnr2_lRACOueRca7resym_iodification HI _asymH r857 85icaTe0te_id 1teSAi_5,857 857 8H?n HI _asymRACOp6nn_angle.ptnr2_a1i_a1i_a1om_id N . 57 85icaTe0te_id 857 8. ? A .ptnr2_lRACOueRca7resym_iodification89t9p_A 3c So6__A 3c SoP57 8. ? A .p 8. ? 3kmsheet_range.end_label_cel_cel_cel_cel_cel_cel_ce_cel_kGes 5f5id _5f5id _f5id _f5i? A3 u 8. ?cd.mF_stru_d.mF_s2.P5id _f5ieatuD,9857 85i6 Gth_s6 _dbx_strg 3c S3c S3c S3c S3c S3c EU32ab3bx_sbx_sbx_? LEU3 _pG2bx_s7G2bx_sdinB 5T d_n-d_n-d_n-d_n-d_n-d_n-d_n-d_n-N ? N1m_n-d_n-d_n-d_n-d_n-d0Tuh3A 108sTuH2Eh3A 10s_sdi3dinB 5T d_n-d_n-d_n-d_n-d_ntloop_ _struct_siQt_coHZNcation89tn-d_ntloop_ _strueet_hbondatom_icati6E 5T d_n-d_n-d_n-d_n-d_ntloop_ _st7 ? Ldatom_icati6E 5T d_n-d_n-ucpdbx__r4U A .8rO4cr_r4U3vrer4U3vrer4U3vrer4U3vrer4rer2bx_sdinB 5T _sdinB muct_conn_aO ARG_n-ucpd6t3cstruct_a ? A ZN 45-d_n-d_n-d_n-d0Tuh3A 108ss 5T d_n-d_n-d_n-d_n-d_n- ? 1uFGA odifit_suct_09PHFGA odiel_cel_e0 eet_hAA1 4 5 N LE7_s A1 4 5 ? LYS Ant8e26 Gti61lNu_latHnt8e26 u 8. ?e0cel_e0 eet_hAA1 4 5 N Le26it_suct_09PHFGA odiel_0cel_e0 eet_hAA1 4 5 lNu_latHnt8e26 u 8. ?e0c3vn-d_n-d_n- LEU3ep_ _strueet_hbondatom_ _struodifiA81_et_G1.d_asym_ran-d0Tuh3A 2ab3bx_sbx_s 3r857 ?v3Y0e _a8VED5label_comp_iS_struct_ 3r857datom_icati6s1.d_asym_ran-d0Tuh3A S _struc _a8VED5label_9hbos 57 85icaTe0ts 3r857 ?vr0ts 8ss 5T e05556H6o63'6E1#6E1#6E1dbx_sfx_sfx_7 ?v3Y0e _a8VED5la4AA2 3 THR A 16wreriN1sfx_7 ?v3Y0e _Y u 8. ?e0cRf3A ASP 90 ?HuD,9857 85i6 GeS 3_as _conn_anuOit odiel_[V[_m_ 3 4el_difbx_sdif94id 2 8. ?efx_7 ?v3Y0e _a8VED5a4AA2 3 THR A 16wr_c 402 ?1_Huct_c 402 ?9(0mE47ns_code _pdbx_struct_creSCOT33i_Vu_comp_struct_co3PZ2r2_auth_cotruOiteS3ruOiteSiostruct_a 79 HFGAcotg487th_atom_id _pdbging sittom_id _pdbging 6ipSiosting sittom_id7 8. ? A .p 8. ? 3kmsheet_rangeMi2e_cel_kGes 5f5sym_id sym_id YthACOueRc2f7 85d.mF_s2.P5id _f site for r6A r6A r6A r6A r6A r6AILE A 48 O TH _strue0ct_sheeA r6A r6A r6A r6AILE A 48d _f5id _f5id _f5id _f5i 3 s.pdbx_evidenW3eaYst0ep_A 3c S48d _f5id _f5id 183 ?oh_attx_str2AAp7er2bx_sdinB 5T _sdinB muct_coer4U3vrer4d 5T _sdn 5T _sdn 5 A1 5r aeh _pdbx_struct_sheet_hbond.range_2_label_atom_id site for aut 3c So6_aging sittomttomttoittomtt_n-d32 eaLte for aut 3c So6_agi2RiZionp _struesidue SO4 A 4092Sr85earallel AA1 4 5 ? E6u5 C ZN0mat_sheett_siQt_coHZN0ew]dkVl_id _pdbging sittom_id _pdbging 6ip6_agibging 6 A 40 _pdbging 6ip6_agibg4ao;3c So6_aging sit]M.OIS A64y8e AQ2pdbx_evidenW4 5 ?e A ZN 403 ?it]M.OIS A64y8e AQ2pdbx_e5dinB muct_coer4U3vrer46Ttml_site_gen.id _struct_site_gen.site_id _site_gen.id _struct_site_gen.se_g8struboUEop_ _ing 6ip6_ag0-pauboUEop_ ag0-pauboUEop_Eop_Eop_tto C ZN0icaTe LYe LYe LYe LYerue0cN 403 ?it]M.OI 5i 37 857 8H? 1Z2r2_auth_cotB2ow]dkV3 LYe Ln _pdbh857 8et_hP66B muct_ 3nd6m3te_gen.label_c4_hP66B muct_ pdbx_modification_featu5ti6E_hbond.rangeangeange 7bx_modificatio6label pdbx_modification_fen_fen_fen_fe_hP66B muct_ 57 8H? ? hP66B muct_id5_res _strct_e.pt _p74Gruct_tomttomttoittomtt_n-d32 eaLte 7 8H? ? hP6id5_res _strct_e.pt _p74Grid _struct_site.pdbx_auth_ins_boUEop_EopH muct7 2 3 N Tidue Z.sdue Z.sdue Z.sA r6AILE A 4 ficat6 AC1 Software AhlPBE A 4 ficat6 AC1 Software_ _t 0g1Iresi5Ee.pbXd ran-d02d odi4 ficat6 AC1 Software_ _t 0g1Iresi5Ee.0eC1 Software_ _t 0g1Iresi5Ee.0eC1 SH 6ip6 AC1 Softwar1Iresi5Ee.0eC1 Software_ _t 0g1Iresi5Ee.0eC1 SH SH SH SH SH SH SH i6scatiostruct_a ? A ZN 402 ?1Irest? 5 SH SH Hture.auth_c402 ? 402 ?1Ire22resiFu23 702 ?1Irest? 5 SH SH Hture.a9PHFGA odiel_0cel_e0 eet_hAA1 4 5 H Hture.a9PHFGA odiel_0cel_e0t_cHre.auth_seq 172 N 402 ?1Ireg1Ire_0cel_e0t_cHre.auth_seq 1S60icaTe LYeiHD1 End.m_ 8]g665.O13End.mF_std.mF_std.mFging 6ip6_ag-d_n-d_auth_cotru1tauth2h_seq 172 N7c3vn Oe5 ? 3_as _conn_angle.ptnr3_auth_at _a8VED5la4Ad_residue_ld_n-d_n7uthGO13EndRc2f7 85d.mF_s2.P5tl_dge.enTloop3el0_m_FHZNcation89tA .ptnr2_lRAOMT076-d_n7uthGO13EndRc2f7RothACOueRc2f7 6nZCnstlNu_latHn5em_iHc2AAp72pdbx_3n pdbx_modification_featu5ti6E_hbonh3ft0ex_modificnn_an6E_hbonh3ft0hbonh3f9e VC2 A 401' AC2Ff9e VC2 e.auth_seq 1S60i N 402 ?1Ireg1Ire_0chbonh3f9e VC2 A 401' AC2Ff93i53ft0ex_modife5p_1nfen_fen_fen_fe_hP66B muct_ 57gq_id 220 _pdbx_ _pdbging 6ip6_agibging 6 A 40 _pdbginn5i6 GeS 3_as _conn_anuOit odiel_[V[_6n_anuOipdbx_modification_feati tomttdbginn5i6 GeS 3_as _conn_anuOit odieln5i6 GeS 3_as 2Nstruct_conn_anH_e.pt _p74Grid _struct_site.pdbx_a.9e8 ? A O8 ? A109 LEU omp_id _pG Oe5p_13s0e.ptpt _p74Grid _IY NE2 ? A HIS 227 ? A HIS 263 ? et_range.end_aH Software_ _t 0g1Iresi5Ee.0eC1 SH 6iPnge.enLx_stS1ucS1ucS1ucS1ucS1ucS1ucS1ucS1ucS1ucS1ificatire_ _t 0g1IrLv # l(T08 ZN ? C ZN . ? A ZN 402 ?k556H6o63'6E1a8tire_ _t 0g166e_aT75tOct_conn_anof SEE1ct_conn_anof SA 10E1ct_conn_anof SA 10E1c2 ?1Ireg1Ire_0chbonhFf9en.site_i1Ire_0chbonhFf3.id _struct_site_gen.site_id _siteasym_id _stb112e_i1Ire_0chbonhFf3.iosite.pdbx_a.?9(0mE47ns_cg 6ip6_agibgOF 263AA1_hbi1Ire_0chbonhFf3.iosa8tire_ _t 0S1ucS16.lab3- V[_m_B. AA1i5cox_LYS A ZN . ?e0cel_e0 g 6ie_ _t 0g1Iresi5Ee.0eC1 Software_ _t 0g1IresiIresi5Ee.0i5IS 2L9 3c So6_aa u'e? A HIS 121 ? 1_555 ZS6reeHS? A HIS 121 ? 1_555 ZS6reeHS? A 16C2 eS6reeHS? A x_? LEU3 _pG2bx_sdinB_agi2RiZionp _S? A 16C2 eSatoB_agificatir 402h0, 4Rllam2l_id _pdbg AC2Fc3)i _pdbgx_sdP6strnB_agi3agi3_id _pdbg AC2rKn3 4 ? anti-parallel2hr4bx_sdinB_agi22Nx_modification_feath0ct7dbx_p_2_authne_geS6reeHYSatoB_agificatir 402h0, 4Ration_feath0ct7dbx_p_2_Ch0ct2.P 1_555 NE2 ? A HIS 91 ct2.P_553ware_ _t 0g1Iresi5Ee.0conn_6 0g1Irest0ex_modificnn_a7(6teSbx_p_2_authne_geS6reeHYSaing sittom_iT2p0eHYSastom_ir3onh3f9e VC2 A 401' AC2Ff93i5s cvtB2owd_n-ug 3_as _conn_angle.ptnr3_auth_at _a8VED5la4A _stt6 ? 6 looB 50 ? LEU3 0ct7dbx_p_2_6E1#6E1d 8et_hP60- ? LEU3 0cC8 ? LEU36scatiostruct_a ? A ZN 4020mE4757dbx_p_2_Ch05T _sdinB mu'ruct_a ? A ZN 4026reeHYSat? LEU36scatiostruct_a ? A ZN gi3_id _pdbg AC2rKn3 4 t_a ? A ZN6R3le AA1 3c_lsb_rTMcZ0t_cgi3_id _pdbg AC2rKn3 AC2rKn3 AC2rKn3 AC2rKn3 AC2rKuvle A. PHE A 191 AA2 3 THR27ti6scatiostruct_a ?4 ficat6 A3 THR27ti6scatii3_id _pdbg A2 5krN 5kr72g665.ct8angA 6 So6_aut THR27g2 5krN iostruct_a ?4 e9odification_pS A67.cation_pS A67.cation_pS A67.cation_pS A67.cation3h)llel pl pl pl pruct_asym_ran-d0TuhZu uuct_sheetseetseet_pS A677.ca3EnD62HrN iostruct_a ?4 e9odificavF_s2.P5itnrodifireSCOT33i_555 NE2 r85el_pdbx3 _dbSr7TC2rd _p2 r85el_pdbx3 _dbSr7TC2y77d5eloSCOT CYS _pdbt8. ?5el_pdbx3 _dbSr7TC2y7 AC2rZN 403e.b_1el pl pl atir 402h0, 4Rllam2l LEU A 83 AA1 5 LEg AC2rK.r2h0, 4Rllam2l LEU A 83 F A 83 F A AC2rK.r2h0, 4Rllam2l LEU A 83 F3BCY. ? A3 id f 83 F3Buth_ins_boUEop_EopHaOd.range_id_1 _pdbx_struct_ranget_sip_EopHaOd.range_id_1 _pdbx_struc3Bt_hb1uct_con hnbxa7d_13_555 _p _pG2bx_sdi ? A3 get_sip_EopH0e _pG O_p _pG2bx_sdi ? A3 _struct_site_gen.site_id Kn3 AC2rKuvle A. PHE A 191 AA2 3 THR27ti6scatiostruct_a ?4 ficat6 A3 THR27ti6scatii3_id _pdbg A2 ruct_sheet_hbond.sheet_id4Lr2h0, 4Rllam0g1I ruct_sheet_hbond.sheet_id4Lr2h0,3B_555 NE2ug1I ruct_sh140 _c_pdbx3yeYn AC2Ff93i5s cvtB2owd_n-ug 3__1 _pdbx_strn63AA1_hbi1Ir9 llel AA2 2 3s90Rpdbx_a.?9(0m_555 NE2ug1I ruct_sh140 _ug 3__155 _p _pG2bx_sdi ? A3 get_sip_EopH0e _3M/S _g2 5krN iostruct_a ?4 e9oeA_e.pt sd5_pdbx_sOlabel_celOlab_cel_celab_3con _3M/S _g2 5krN iost_site_gen.site_id Kn3 AC2rKuvle A. PHE A 191 7cat6 A3HR27ti6scatii3_id _?4 e9oeA_a8VEOi 76 Rh HI _stnHFGA odiel_0VEOi 76 Rh HI _stY5itnrodifireSCOT33i_PT CYS _pdbt8 7oFndR5?__pdbt8 7oFndR5?__pdbc_pdbx3yeYn AC2Ff938VED5label_comp_iS_st5label_cYonn_anof SEE1ct_conn_anof hbi1Ir9 hAA1ion_7uthGn_anof SEE1ct_conn_anof hbi1Ir9 hAH . _pdbxIr9 hAH .cation3h)llelrKuvle A. P318O0U omp_id _pG OM5b_3con _3M/S _g2 5krN _g2 5krSCOT33i_555 NE2Yx?sre_0chbonhFf3.iosa8tire_ _t 0S1ucS16.lab3tLV ?voMSCOT33i_555HngA 6 So6_aut THR27g2 5krN iostruct_a ?4 e9odification_pS A67.cation_pS A67sSCOT33i_555H5Li1Ir9 str,9 str,9 str,9 str,9 str,9i str,9i str,3 id f 83 F3 e A 83 F A AC2rK.r2h0 tr,9i str,96e36B muct_ 57gq_id 5Fl_pdbx3 dpdbx3 diiel_[V[_6n_a6n_a6n_97Bd 139e8t8e Fie3b6n_a6n_a6n_97B site for rHx8rSCuthGn_anof SEloop_eLA67.cation_pS A67sSR55 _p _pG2bx_sdi ? _a6n_a6n_97B sDFau loo_i2n_a7(6teSbx_Y A2 ruct_sh09e8t8e 1nG83ification_feature.category _a7(6teSbx_Y ADF96e36B m2_l Ath_seq_d Sof Sucym_id sym_id sid sid 5oTx_Y ADF96e36B m2_l Ath_6e3 ? A HIS 227 ? A HIS 263 5F57 8. ? Aym_idc_idc_idc_idcAym_idc_idc_idid sid 5oTx_Y ADF96e36B m2G4 ZN 4026reeH8dbc_pdbx3yeYn AC2Ff938VEnstruct_a ? 5T 4onnsl5?9l5?9l5?m2G45.O13End.mF_stru_labion_7utie3b6n_a6n_a6n_97Bl_cYonn_anof SEE1ct_tion_featuF2c_il5?9l5?m2G45tnrodifireSCOT33cation_feature.category _a7(6tRh)llelrKuvle A. P318OsSCOT6teSbx_Y ADF96e36B m2_l Ath_se.stn.label0_m_ 367(6tRh)llelrKuvle A.labeu6e042iteS3ruOiteS3onh3f9e VC2sbation_pS A67.cg looB 50DF9s7ADF96e36pdbx_molooB 50DF9s7ADF96e36pA36pA36pA36pA3e36pdbxe6pA3e363 re h5' CYi_a1i_a1om_id N . 57 85 220 _p 86 ? A HIS 116 ? 1_555 ZN d ]pG2bs 220 _s 46s 220 _p 86 ? A H6 ? A H6 ? A H6 ? L4g0 ALA A 183 ? N ? A H6 ? L4g0 ALA Ar L4g0 A3Se ALA67.cat3idt3idt3idt3idt3idt3idt3idt3idt3idt3idzt3idt8 hnbxa7318Os6 ? L4g0 d.mF_st3uthGn_anof SsSRn6 SsSRn6 SsSRn.site0Tf SA1 4 5 lNu_latHnt8e2tire_ _t 0S1ucl05556H6o63'6r L4g0 3The?3 pbxe6pA3 3c So6__A G2bx_sdi ? _a6n_a6n_97B sDFau loo_i2n_a7(6teSbx_Y7atHnt8e2tire_ _t 0S1ucl05556H6NeeM/S _g2 5krN _g2 1d.raYst0e3T9e VC2 Ai 86 ? A HIS 1Ddi4 fHIS 3xoYst0e3T9e VC2 Ai 86 ? A HIS 1Ddi4 idzt3idt8 hnbxa7318Os6 ? di46 ? di4nof 172 N7c3vn Oe5 ? 3_as ellam0g1I rucs ellEnd.mF_stru_labion_7utie3b6ntion2_aut6_ u6 nktT _sdinB muheet_hbond.range_2_label_seq_0chbonhFf3.i H6 _labion_73b6ntion2_aut6_4g0 ALA A 18vle A.labeu6e042iteS39iu6 nktT va_pd0at3idt3c7ti6scatii3iteS ? A H3c7ti6sVE2Sl3YPDB_ins_codge. ZNV05556H6NeH6NeH6NeH6NeH6NeH6NeH6Nehnbxa7318Os6 ? di46 ? di4nof 172 N7c3v ? di46 ? d_cel05556H6NeH6NeH6NeH6NeH6NeH6NeH6NeH6NcM3v ?3LE?3LE?3LE?3LE?A3 r_o'2_l Athtruc A 108s0e res _str6u68bx_strudS2Hi_stru_labion_7utie3b6ntion A 12q_0chbW3eet _stnHFGA odiel_0VEOi 76 eW3eet _stnHFGA odiel_6B mux_s3F3l_6B ni AA1 4 3c_l AA1 3c_lsbon A 12q_0chbWdbx3yeYn ACtion2_aut6_ 12q_0chbWCe'6odieel05556H6NeH6NeH6NeH6Ne12q_0chbWabel_0onh3f9e VC2sbatiHtt TC2rd _p2 r85elSsdinB mS2HiHtt tt tt Ot TW3 TW3 TW3 TW3 TW3 TWI36B m2_l Ath_6e3 ? A HIS 2pA36pA36pA36pAid 3f56H6NeeM/S A362rGm2_l Al Al Al S 1Ddi4 fE?30Y NE2 ? A HI86Al S 1Ddi4 fE?30Aid 3f56H6NeeM/S A362rGm2_l 4Rlla4e for D ZN . ? ? 3_as ellam0g1I rucs ellEnd.mF_stru_labion_7utior 4Rlla4e fo0SCOT33i_555H5Li1Ir9 str,9 str,9 str,9 A#ii_555H5Li1Ir9 str,t3idt3idt3idt3idt3idt3idt3idt3idzt3idtlior 4Rlla4e fo0SCOT33iSnd.mF_sy362r3EndRPeH6Ne12q_05 99X2 1 2 N vdtl_featur ? N ALA A 138 O ARG A 13 ? N Eabel63'6r L4g0 3Tht6g L4g0 3Tht6g_struct_sheet_hbond.ranect_sheet_hbond.ranect_sheet_hbPeetGg_struct_sheet_hboONeH6NeH6NeH6NeH6NeH6NeH6NcM3v ?3LE?3LE?35 _p 5re_ _t 0g1Iresi5Ee.pbX3_pdbx_struct_96Ttml_sbDB2oEU A 53 ? d_re3 53 ? d_re3t_hbond.ra9.ra9.ra9.ra9.ra9.ra9.ra9ihvd.ra9.ra9stru_labion_7utie3b6ntion2_autix_? LEU3 fI3didt3idion2_autix_?t9Wlsbon A 12q9.ra9idt3idion2_auidt3idion2_a8fication_feature.type 9jtion_vM5b_3conteature.typed7Htt 1IresAC3 Sof Sof Soet_hbond.raY6uth_ins_codea4e fo0SCOT3el63'6re3 nNcM3v ?3LE?3LEet_hbond.raY6.ranect_sheet_hbond.t_range.LE?3LEet_hbond.raY6.rane_label_comp_id CYS_? LEU3 _pG2bx_s7G2bx_sdinB el_comp_At_hbot_id CYS_? .ix_s7G2bx_sdinB el_cinB elirange.LE?3LEet_hbondd_resmF_seH6NeHnB elirange.LE?3L0 3T76pdbxem2_l Ap_At_hbot_id CYS_? .ix_seory CYS_? .ix_s7G2bx_sepbX3_pdbxBLMe A.labeu6e042iteS39iu2tire_ _t 1ins_ _a7(6tRh)lpQ6?3L0 3T76pdbxem2_l 3T76p8_vM5bd.r8vle A.labeu6e176p8_vM5bd.r8vle A.labeu6e9jtion_vM5b_3contb6ntion2_autPe176p8_vM5bd.r8vle A.labeu6e9jtionfo0SCOT33i_555H5Li1Ir9 str,9 str,9 st0videnW3eaYst0ep_A 35i6e3 _dbSr7TC2rd _p2 r85el_pdbx3 pstr,pTEesidue SO4 A4ion2_autPe_? 1 57gq_id 72Pe_? 1 57gq_d.mF_st3uthGn_,AC3 Sof Sof Soet_hbond.raY6uthA2e_label_compi . ? A ZN 405icaTe0te_id 1ttio405icaTe0te_id 1t.raY6.ranect_sheet_hbond.t_range.LE?3LEet_hbond.raY6.raneaTe0t6bond.range_2_labyuesiduange.LE?3LEe,eBLMe 5Li1Ir9 str,9 stb l3'6E1a8VED8QED556He_0cel_e0t_cHre.auth_s 28 ZN 40Tuh3ft0e3Ae A'e_g2 56A 3c SoP57 Hr6C_0cel_e0t_cHre.aSoP57 HVC2sbation_pS ED8QEp _pduan6_mduah140h148_v51A 3c SoP57 _hbot_id CYSoP57 HVCid 3f56H6NeeM/S A362rGm2_l Al Al 7gq1mr3_,? 1 57gq_idq_idF_st3uthGn_,AC3 Sof6C_0cel Sof6C_0cel Sof6C_0cel Sof6C_0cel Sof6C_0cel Sof6gen.site_id _suTd fe.auth_s 28 ZN 40Tuh3E?3Ls4MIfication_feature.ordinal_0cel S-S,el S-S,el S-S,el S-S,el S-S,el S-S,el S-S0l S_stru uc A 108sD4d _p2 r85el_g8sD4d _p2 r85el_g8sD4d _p2 r85el_g8sD4d l1A_pdbx_modification_feature.lEe.pbX3Sl36C_0cell_g8sD4d _p2 r85el_ Al Al 7gq1mr3_,? 1 57gq_id054m21dbx_stru8sD4d l1A_p1Jtion_feature3nnond.range_2_6AILE A 48d gpeS3ruOit1mr3_,? 1 57gq_id006 M 82q_id006 gpeS3ruOiDA3 ge3uouiO,B ni AA1 4 3eS3ruOit1mr3_,? 1 57 ni AA1 4 3eS3ruOit1Oit1Oit1Opt1Opt1Opt1Opt1Opt111111111111111111111 82q_id006 gpeS3rAon_feature.ordinalH7OOit1Oit1Oit1eS3ruOit1mr3_,? 1 57gq_id006 M 82q_irdinalH r8F_st3uth7B site ad _p2 r85el_g8sD4d l1A_pdbx_modifion_featg1Iresi5Ee.pbX3_pdbx_sf SE53 ? d_re3t_hbond.ra94_hbond.raY6.ralS-S,el S-S,e.me8os 57 85ic_site.pdbx_auth_ins_boUEop_EopH meOooB 50DF9s7ADF96es4 82q_irdinalH r8F_st3Wpt1Opt11111it1Oit1Opt1Opt1Opt1Opt1OpbpQ6?3L0 3T76pdbxem2_l 3T76p8_vM5bd.r8v 0ct7dbx_p_2_6E1el_ Al6ck5sreS3ruOit1mr3_,? 1 57gq_iboUEop_EopH meOooB 50DF9s7ADF96es4.auth_s 28 Zk5sreS3ruOit2iboUEop_EopHph_asym_id _T3L0 8ck6e3 6ntion A 12q_0chbW3eet _stnHFGA odiel_0VEOi 76 thGn_anof SsSMavOknge_2_labet_hk5s 76 G5id 3f56H6NeeM/S AD_labk46f7u 1_555 11p.Peg1Ire_0cel_e0t_cH11p.PeyLA_pdbx_modification_featureT1Ir8 ? LYSe7 ? LYSe7_4h7_4h7_4h7_4h7_4h7_4h7_.r8v 0ct7dbx_p_2_6E1el_ Ale.ptnr3_auth_at _a8VED5lame8o5Ee.pcation_featu5ti6E_hbonh3ft0ex_modif_hbonh3ft0ex_modif_hbosa8tire_ _t 0S1ucS16.N _pdbx_Gwle.ptnA1ucS16.N _pdbx_Gwonh3ft0ex_modif_hbosa8tire_ 6.N s3lPeg1pdbx_Gwonh3f73E?3Ls4MIficat yc2f7R2f7R2f7R2f7R2fis5h3f73E?3Ls4MIfica0ep_,7R2fr ? LEU8GwH7OOiid is5h330ep_,Hanec7f SsSMavOkngnD4d _p2 r85el_g8sD4d _p2 r8.r80,2feature.lEe.D4d _p2 r8(HR A e_g2 56A 3c SoP57 Hr6R2fr ? LEU8G11111it1Oit1Opt1Opt1Opt1Opt1OpbpQ6?3Ln_ff8m.ptnA1ucl6-a2 56A 3c SoP 2Sl3YPDB_ins_codgep8anof SE2.uich7_4h7_4h7_4h7_4h7_. NuOiteIfickn1Jtio plR A Eware_ _t 0MDe0t_cH11p.PeyLA_pdbx4 Eware_ _t 0MDe0t_cH1 p2Ga57gq_id006 M 82q_irdinalH rSGwH7OOiid iA A 168 ? O02q_2f7R2f7sSRnfnalH rSGwH7Ci5Ee.pbI0SRn.site0Tf m_id _T3L0str2AAp74_A 43 ? THR A 47ia168 ? O02q_2fq_2fq_2eVc2f7R2f7R2f ? Odl S_ft0ex3idt3idt3idt3idtA0str2AAp74_A 43 ? THRat3idtA0strruct_conn_angtrct_e.pt _p74Gr?v3Y02bx_R A 47n _3M7.d7R2f ? Odl S_ft0ex3idtscatiostruct_a ? A e3 _dbSr7TC2reTC2y77d5eh7_4h7_. N56A 3c SoP572 ?1Ireg1Ire_0cel_e0t_cHresrR]bx_R7R2f ? Odl S_ft0ex3idtscatiost665.O13End.mF_stru_Ee.pbI0SRn.sit7Y6uthA2e_la702 ?1I1 5783 F A 837gq_iboUEop_e3T9Ydtscatiost665.O13E_irdinalH r8truct_a ? A e3 _db2e_la702 ?1I1p7702 ?1I1p7702 ?1I1p7702 ?1Ioft _db2e_la70HIS 88 ?2l_id _pdZ23idtscatiostm3T90str2AAp74_A 43 ?_36H6NeeM/S A362rGm2_l 46NeH6NeH6NeHHi56uthA2e_la702 ?1I1 5783 FpiavOkngnD4d S 85Hi56uthA2e_la70d iA A 168 63End.Gm2_l Al Al 7g_auth_comp_id _struc_iresidts3_3 EwaHresidts3_3 EwaHresidts3_3 EwaHresidtB7ia168 ? O02Y6n_9 EwaHres.d _p2 r853End.Aet _db2e_la70HIS 88 ?2l_9 _p2RT3_hbonh3ft0ex_modif_hbosa8tiresS1ucS16.N _pN _pN _pN _db2e_la70HIDb2e_la702 ?1I1p7702 ?1I1t 0MDeIAl astb112e_i1Ireep_,7R2fr ? LEU,7R2fr 4h7_4h7_.rl2l_9 _p2l_9 _p.uct_702 ? FpiavOkngnD4d S 85Hi56uthA2e_la70d difet_702 ? Fr_4h7_.rk ? 1_555 ZFRl6nt23if_7c2 r853End.Ae5Hi56uthA2e_lavOkngnD4d _p2 r85elNuct3Y0eE_db2e_la70HIDb2e_la702 ?1I1p7702 ?A2e_lavOkngnD4 A 4 A 4 A 4 A_id N .Llam2l_id _p46 ? d_cel05556H6NeHd.mFs14 AA22icaCx9'6E6Ne3eet _stnHvu _pdbx_strid N .Llam2tificnn_a7(63_id NH7(63_id NH7(NH7(NH76scatiostruct_a1 AN03 _t 0MDe0t_cH1 p2Ga57gq_idnD4nGa57dinBC6tificnn_a7(63_id NH7(63_id NH7(NH7(NH76scatiosty853E 7R2cS3ruOit1mr3_,? 1 57gq_f_7c2 r853End.Ae5Hi56uHIS 88 ?2l_9 _p2Rr?v3YtcC8 ? LEU367C2rKnhA_ide_la7p_2_6E1el_ Ale.ptA_ide_la7p_2_6E1el_ cdt3idt3idt3P6E1_labion_7utior 4a7p_2_6E1el_ Ale5 pdbxMxMxMxMx_6n_anuOipdbx_modeetseet Al6 S 85Hi56uthA2e_la70d iA ATi56uthA2e_la70 pdbxMxMxMxMxMxMxMxMxMxMxMxMxMxMxMxMxMxMxMxiostruct_a ?4 ;xMxMxMxMxc0Mxc0Mxc0Mxc0Mxc0Mxc0Mxcst5p_i1_555R1el_xMxMxMxMxMxMxMxiostp2 r85elNu6ct_a ?4 ;xMxMe_ _t 0g166e_aT75tOct_conn_a ?4 ;xMxMe_ gq_istnHtcC8 ?Q A_id4 xMxiostp2 r8t_a ?i66uHIS 88 ?2ls5tOct_t_a ?i66uHIS 8ruct_e_hp_8 ?2ls5tOcLYS A 105 ? Abls5tOcLYSbQtOcLYSbEeetseet Al6 7epB7ia168 ? O02Y6n_9 MxMxMxMxMxMxiostp2 r85elNu6ct_F96es4 82q_irdinalH r8F_st3Wpt1Opt111Ytc67(6tRh)lle51Rb133ct_fication_feaVD51Rb133ct_fication_B7ia1Y2q_iel_ e6_ e6_ e6_ e6_ yc2f7R2f7R2f7R2f7R2fiip6_agib_ e6_ e6_ e6_ e6_ n_Vu_cq_iel_ e6_ e6_ e6_ e6_ yc2f7R2f7R2f7R2f7R2fii2f7R 40 _i strcLYS A 105 ? Abls5t2 ? A HIS 91 ct2.P_553ware_ _t 0g1Iresi_sheetseehE_553ware_ _t 3uth_s 28 Zk5rct_SsSK r8F_stEUpB7iat 3uth_s 28 Zk5rct_SsSK r8F7 Aym_idc_idc_iMxMxMxMxMx8iK r8F7 Aym_id3i 76 thGn_an N56el_ Ale.ptAbptAbptAbptAbpt NH7(NH7(NH7utior 3c_9strcL8ibpt NH7(NH7(N3pbX3_pdbx_sf 133ct_ficati6scatiostruQNE2 ? A NE2_str_fea Aym_idc_idc_iMxMxMxMxM scontb6ntioNE2_stdbx_str1ym_idc_idc_iMxMxMxntruQO727 Abls5tOcLYSbQtOcLYSbEeetseet Al6 7eMxMxMxMxMhGn_anof SsSRn6 SsSRn6sSK r8F7 Aym_itom_idiSRn6 SsSRn6sS3e8o5Ee.pcatiMxMxMxM scontb6ntioNE2_stdbx_x_mod7HtU_A t0e 214 ?2_stdC2rKS_ft0ex3idtscatpcation_featu5ti6E_hbonh3S_ft0ex3idtscatpcation_featu5ti6E1M4lidtscatpcation_fe'ia168 ? O02Y6d ngeange 7bx_modificavxMxMxiostRcpe eH6NeH6NeH6Nehnbxa7318Os6 ? di46 cotB2ow]dkV3 ngeange 7bxnge 7bx_modifiu0Du6ct_a ?4 ;xcuct_a ?4 ;xM6DPon_feaVD51Rb133ct_fication_B7ia1Y2q_ie 4Rllam0g1I ruct_sheet_hbond.sheet_id4Lr2h0,CueaVD51Rb13uheet_hbond.range_2_l ? 1_555 ZN d ]1Rb13uheet_hboug 3__1 _pdbx_strn63AA1_hbi1ue SO4 A4ionSbx_Y AD2ge_1_SRn6sCueaVD51Rb13uheft0ex3idtscatpcation_n6 SsSRn6sS3_0chbonhCueaVD51Rb13uheft0ex3idtscatp1 2 N vdtl_featur ? N ALA A 138 O A43ct_f44_MxMxMn8 O A43cti2f7R 40 _i strcLYS A 105 ? Abrg3pTs0eft0ex3idtscatp1 2 N 3eP_4h7_.rk ? 1_555 ZFR 3eP_p1 2 N vdtl_fnK40 _i strcLYS A 10 _?4 e9_0cel_e0t_cHE1ct_tio6105eHsa8tire2mthA2e_la79 _p2RT3_tGQ3pTs6SO4 A4ionSbx_Y AD2ge_1_SRn6sCueaVD3i.dt3idt3Fs14 _pdbginn5i6 Gefr ? LEU8G11111it1Oit1RTc6tscatiostm3TnCueware_ _t 3inn5i6 Gefr ? LEU8G112catiostm3TnCueware_? A e3 _db2e_la702 ?1I1p7702 ?1I1p7702 ?1I1p7702 O A42Rr?v3YtcC8 ? LEU367C2rKnh3JF8lQ32 Ai S6 r8F__cH3pf r8F_st3Wpt1t_f44_MheetNVD3i.dt3idt3Fs14 _pd5elQ_hb02 ?1,u13A23D3i.dt3idt3Fs14 _pd5elQ_hb02 ?1,u13A23D3i.dt3idt3Fs14 pbX3_pdbx_sf 133ct_ficatipA36pA36pA31db2e_la702 ?1I1p7702 ?1I1p7702523D3i.dt3idt3Fs1c1 _g2 5krS 3i2tOcLYS A 105 _anof hbi1Ir9 YS A 105 _anof hbi1Ir9 YS A Y23D3i.dt3idt3Fs1c1 _hi2tOcLYS A 105 _anof heOLtiostm3TnCueA Y23D3i.dt3idt3Fs1c1 d5elQ_1scatiostt_anof heOLt_9strcL8i1cS16.N _pN _pN _pN _db2e_la70HIDb2e_la702 ?1I1p7702 ?1I1t 0MDeIAl astb112e_i1Ireep_,7R2fr ? LEU,7R2fr 4h7_4h7_.r0g6 c87R2fr 4h7_4h7_.r0P ?2l_9 _p2Rr?v3YtcC? 1_cLYS A 105 _anof heOLtiostm3TnCueA Y297_.r0P 74_A 43m (0Yst0105 _anof heD60 ALA Ar L4g0 A3Se ALA67.cat3idt3l302 ?1,u13A2S7e74LA67.cat3idt3l302 ?1t_9strcL8i1cS16.N _pN _pN _pN _db2e_la70HIDb2e_la702e_la6(i.dt_9s'e_g2 56A 3c SoP57 H3ionRi8A67.cation_pS A67sSR55nr 56A 3c SoP57 H3ionR)h0cf6C_0cel Sof6C_0cel Sohboug 3__1 _pdbx_strn63AA1ion_pS Aication_B7ia1Y2q_ie 4RllamTf6C_0cel Sof8N6utrud_anof heOLtiostm3TnCueA Y297_.r0P 74_A 43P2e_la odiel_0VEOi 76 eW3eet _stnHFGA odiel_6B mux_s3F3l_6B ni AA1 4 3c_l AA1 3c_lsbon A 12q_0chbWdbx3ytiostm3TnC _p2RT3_tGQ2 CYSoP57 H3_tGQ2 CYSoP57 H3_tGQ2 C0 r,9 str,9i _ yc2f7R2f7R2f73bx_modifiu0Dm6_ S6_ S6_ on_feaVD51Rb133ct1.dt3idt3Fs14 pbX3es_struct_sHFGA odiel_6B8X3leet_id4Lr2h0,CueaVD51RBaTe0tcB0,CueaVDuea6s14 AA22icaC7006reg1IretvidenW3eaYst0ep_A 3103on_feature.lab1sce.l/ uu0Dm6_ S6_ S6_ on_feaVD51Rb133ct1.dt3iodiel_6B mux_s3F3l_6ptscatSabel_sef3083Fs1c 168 ? O02Y6n_9 MxMxMxMxMxscatSaL4mne'iPTreg1GKnh3JF8lQ32 Ai S6 r8F_1c 168 ? O02Y6Z_9 MxMxMxMx71.dt3iodiel_6B mux_s3F3l46.3-168 ? O ? O ? O ?Na1Y2q_ie 4RllaR _t 0g1IrLv -M AA1 4 3c_l AA1 3c_lsbo6eHe A.4aR4a291heOLtiostm3Tnn6ea6s1m3Tnn6iodielA1 3c_lsbo6eHedt3Fs14 pEA2xntruQO727S6_ on_feaVD51Rb13 iA AY7e74LA67.cat3idt3l302 ?1t_9strcL8i1cSeRc2AA1 Oe5p_13ct_sitstruixMxMxrcL8i1cSeRc2AA2Sl3Y013ct_sitstruixMxMcatSabel_sHaYst0ep_A 3103on_fearcL8i1ct_id4Lr_bxa7318Os6 ? L4g0 d.mF_s?6nn6eaaYst0ep_A 310'2S860 ALA Ar L4 A c2f7R2f7R2f7R2f7R2find.mF_stru_Ee.pbI0SRn.sit7Y6uthA2e_la702 ?1Iu_Ee.pbI0SRn 40 _i strcLN1 3c_lsbo6eHedt3Fs14 pEA2EA2x2f7R2310'Satpcati9iRn.sit7Y6l_g8sD4d _p2 r8.r80,2feature.lEe.D4d _p2 r8(HR A e_g2 56A 3c SoP57 H1t_SsSK r8F7 N0t_sheet_hshee0icatiostr_lsbo6eHedt3l5r L4abk4l0rvM/S 6h80,2feat3idt8 hnbxa7318Os1,2feature.lEe.D4d _p2 r8(HR A e_eature.lm21mplR A Evm3TnCueA2ei.dt3idl2w2065N1 3c_lsbo6eHedt3Fs14 177R 40 _i strcLYS A 10677R 40 8Os6 ? L4g0 D51Rb13uheft0ex3idt3idl2w206522ruct_96Ttml_sbDB2oEU A 53 ? d_re3 53d_re6h80,2feat3tion_feature.type Ndt3idt3Fs14 S6AH63l5r S6A3Vstype Ndt3idt3Fs14 S6AH63l5r S6A3VseHNdt3idt3Fs14 S6AH63l5r S6A3VseHNdt3id CY_lsb 177R 40 _i strcLYS A 7R 40 _i strcLYS A 7R 40 _i stm0HID6re_ _t 0MDe0ha9S.Nc2f33B92065N1 3c_lsbo6eHedt3Fs14 177S A 7R 7 CYSo14 stm0H6h 40 _40 eh3apTDPa702s14 t3idt3Fs14 S6AH63l5r S6A3Vstype Ndt3id3#rucA 43 ?_36H6e_ _t 0MDe0h1sce.l/ uu0Dm0h1sce.li1cS16.N _pN5ws14 2Y6Z_9 Mxt3ws14 2Y6Z_9 Mxt3ws14 2Y6Z_9 HaYst0ep_A nd.raY6uthA2e_label_compi?6h7R2fron_fcpe6o 17bo6eHedrQ32 Ai S6 r8B_6E1st0ep_A nd.raY6uthA2e_label_compi?6h7R2fron_asn.lab3- anti-pa0nCueA aR2fronanof p_A nd.raY6uthAuthAut3c SoP57 Hr6C_0cel_e0t_cHre.aSoP57 HVC2sbuthAboUEop_EopHph_asym_id _T3L,b2e_la70pHph_asym_id32 0MD6A2x2fsdpe6o9bf7R2l_0VEOi 76 thGn_anof SsSMav]. 3T76p8_vM5bd.r8vle A.labeu6e1nC7006reg1IretvidenW3e2D51Rb13uheft0ex3idt3ieu6e1nCT76p8_vM A 7R 40 _i T3L4g0 D57es4 82q_irdinalH r6pA36pA31db2e_la702 ?1I1p7702 ?1I1p770252fr16.ralS-S,el S-S,e.me8os 57 85ic_site.pdbxEe.pbX3_pdbx_sf SHYpe.Mxios.t9Wl77025Rlpe6o9b EAt3idt3Fs14 Sa9st9b A 1ure.typed7Htt 1IresAC3 SoP AAc2AA2Sl3Y013ct_sitA 1ure.typed7o SoP AAc2AA2Sl3Y013ct_sitA 1ure.typed7o SoP AAc2AA2Sl3Y013ct_sitA 1ure.typ70pHph_asym3Y013ct_sitAym3Y0tAym3Yp8_8F8_8F8kp70pHph_asym3Y013ct_sitA1t C3 SoP Anr3_authp_A nd.raY6u_irdinalH r6pA36pA31db2e_la702 ?1I1p7702 ?1e.bx_st317702 ?1e.bx_st ut_hP66B muct_ m3Y2 ?1e?1e.bx_2eture.type Ndt3idt9bu_iS6Xsym_id _T3L,b2e_la70pHph_asym_id32 0MD6A2x2fsdpe6o94 e9oeA_a8VEOt1mr3_,? 1 57goP53e?1r3_authp_A n7p_2_6E1el_ cd0r3_authp_A n7p_2_6E1el_ cd0rOt1mr3_,? 1 57goP53e?1sym_2AA1 K5HRbCOueRc2AA1 Oe5p21mpn30t6bond.range_2_labyuesiduange.LE?3LEe,eBLMe 5Li1I_2_labyues ?t_VD51Rb133ct1.dv33ct1e61rucKnh3JF8lQ33yuesiduange.LE?3LEe,_9strcL8i1cS16.N _pN _pN Y5authvOkngnD4d S 85Hi56re_0cel_etm3Tla70 85Hi56re_0cel_etm3Tla70 85Hi56r_sitAf7R2f7sSRnfnalH rasyu4T6reiost66ie_0cel_ete)3 85Hi56re_0cel_etm3T_ on_feaVD51Rb13 i2s1413 i2s rasyu4T6reiost66ie_0cel_etetviditAf7R2f7sSaY6utNaY6u3LEe,_9strcL8i1cS16.N _pN _pbx_2e_la70pHph_asym_id32 0MD6A2x2fsdpe6o5HRbCOueRc2Albx_modifiu0DAu3LEe,_9st _pbx_2e2 ?1e.bx_st v0MD6A2xe6oP0DAuD5HRb0DOmF_s?6nn6eaaYst0ep_A 310'2S860 Atyped7Htt 1IresAC3 SoPd7Htt Nt317702 ?1e.Nt31e_g2 e_0celP0DAu6a3#rucA 43 ?_51RbsJoUEop_E?1e.Nt3TIQ_9 EopavOknge_2_lr8v 0ct7dbx_p_2denW3eaYst0ep_A 35i6e3 _ducA 43 ?_51RbsJoUEop_E?1e.Nt3QID6re_ _t 0MDe0ha9S.Nc3 06o4h7_6e 7b-ug _3 SoPd7Htt N3 cation_fe'iQID6re_ _tn-d_n-d_n-d_ntloop_ _st7 ? LnS_Wnd.rE376U0ct7dbx_p_2_6E1oop_ _s_2_6E1lpe6o9b EAt3at3idtA0strruct_conn_angtrct_e.pt _1e.Nt31e_g2 pzo 1ure.typ70pHph_asym3Y013ct_sitAym3Y0tAym_ _s_2_6E1lpe6o9b on_BE9st _pbx_2e2 ?1e.bx_st v0MD6A2xe6oP0DAuVbsJoUEop_E?1e.NtqStAym3Y0tAym_ _s_2_6E1pzR A uVbsJ6eS.9b o)6E1p-AAc2AA2SAc2AA2SAc2AA2SAc2AA2SASp_E?1e.NtqStAym3Y0tAyYxtrct_e.pt _1e.Nt31e_g2 pz70 85H7p_2_6E1oopH3Y013ct_sioopH3YpH3YpH3YpH3TfStion_pS A67sSCOT33i_5 47n _3M7 D57es4 82q_irdi3Ytc.3 _ducH3YpH3YpH3TAC2AA2Sl3Y013ct_sitA 1ure.ty2h0, 4Rllam2l LEU A 83 F A 83 F A pTs6p2AAc2AA2SAc2A StAym3Y0tAym_ _s_2_6dthp_A nBE9s-tAym3Y0tAyU3Q nBE9s-t_hbond.ra11itp_StAym3Y0tAym_ ngnDMA n7bx CY5_hbetd 5tOct_conn_anof SEEym_id sym_id si #rucA 7 P318OsSCOT6teSbxOT6teSbxOTr6,_9stA2EADc3 01Oit1318Osf2uthA2e_label_.bxOTr6,_9stA2EZA0A2EADc3 01Oit1318OFRl6nt23if_7c2 r85st0ep_A 35iu6nt3bxOTr,b2e_la70pHph_asym_id8rl3sp2AA A67sSCOT33i9OQ3O2SAc2AA2SASpVb 3 F A 83 F Nt31770dpe6o9bf7R2l_0inalH r6pA36pec9.t 1IresAC3 SoP vA2EAsDMA n7bx CY5_hbetLfor3i9OQ3O2SAc2AA2SASpVb 3 F A 3 F A 3 F A 3 Fnof SEEym_id sym_i_ _t 0MAmcate83 4LDMA n7bx Cp74_A 43 c2AA13e_ _t 0pex_modif_hbosa8tire_ 6.N s3lPeg1pdbx_Gwoe_ _t 0pex_mod3e_ _t 0pex_mod3e_ _t 0pex_mod6AILE A bel_.bxOTr6,st0e6g2 2st0e6g2 2st0_i_ _s?6nrTPtGQ2 CYSoP57 H3_tGQ2 res t1Opt1Opt1111I S 3eS3r218_ S6_ on_feaVD' omp_id _pG OM5b_44_M67sSCOT33i_5 47n _3MA22icaCx9D' omp_i/HIS 2pA36pA36pA36pAid pcpA31db2e_la7CYSoP57 H3_tGQ2 C0 r,9bt23if_iW5 47n _3MA22icaCx9D' omp_i/HIS 2pA36pA36pA36pAid pcpA31db2e_la7CYSoP57 H3_tGQ2 2 2 2 2 2 0Opt1Opt1OpbpQ6?3L0 3T7iM/S 6h8cS16.N _pdbAoP vA2EAsDMA AsDMA AsDMA AsDMA AsDMA AsDMA AsDMA AsDMA AsDMA96DA AsDMA AsDMA96DA AsDMA AsDMA96DA AsDMA AsDMA96DA 9avOkngnD4d _p2 r85el_g8sD4avOkngnD4Ys4m_0celP0DAu6a3#ruS_e0t_cH11p.PeyLA_pdbx_modifi0ex_modif8gnD4d _p2 r85el_g8s__modification_feustn.ltn.lt9u8angA 6 'g3l_g8s__modification_feustn.ltn.lt9u8an Mst0e6g2 2sI4ditn.0e6g2L0e6g2LA36pA36pA36pA_cH11p.PeyEop_EopH meOooB 50DF9s7ADF96es4.At1Opt1OpbpQ6?3L0 3r rsite 2t_hbon,e_id 4Rlla4e _2e2t1Opt1OpbpQ6?3L0 3r 'loo0ex_modif8geFS AD_labk466most664tAyU3Q nBE9s-t_hbond.ra11itp_sooB 50DF9s7_p7F9s7_p7F9s7_p7F9s7_p7F9s7_n_feustn.ltn.lt9u8anr6o9b EAt3athi #rucA 7e3JF Nt3Rlla4e _2e2t1Opt1Op AsDMA AsDMA AsDMA AsDMA AcA D6A2xe6oP0DAuVbsJoUEop_E?1e.NtqStAym3MA AcA e6oP0DAuVbsJo4T6reiost602 2sI4ditn.0e4 _pd5elQ_hb02 ?1,u13AA2nAA2nAA2nAA2lFb 3 F A 3 gC01id43AA2nAA2nA Nt3177R 2 0Opt1Opt1OpbpQ6?3L0 0Dm0h1sce4dc6 03O2SAc2AA2SA_pd200 LGware_ _p7R 2 0O7R 2 0O7R 2 0O7RmRSIof SsSRn6 Sssce4dc6 03O2SAc2AA2SA_pd200 h_asym_id32 0MD6A2x2fsdpeAc2A 03O2SAc2AA22AA22AA22AA2lFb EopH meOooB 50DF9s7ASAc2AA2SA_pd200 h_asym_id32 0MR 1IresAC3 p2SAc2AA22AA22AA22AA2lFb EopH me2fpbpQ6?3L0 0DP 4692AA22AA22AA3L0 3T7iM/S 6h8cS16.N _pdbAoP UAid pcpA37t1Opt1111I S 3n.site_i1IA22A5ti6E1M4lidtscatFS AD_lab3A2SdZ23idtscatiostm3T90str2A4gY.typ70p_3M7 D57est_hbo7flFb EopH meOZ23id590str2A4gY.typ70p_3M7 D57estd90str2A4gY.typ70p_2A4gY.typ70p_3M7 D571zc_l 702 ?1IlQ335res _strct_ee1 A HIS 88 ? As9odi- Z4 S6AH63l5r S6A3VseHNdt3il_9 _p2l_9 232l_9dt3i6Anof SsS4beg_dbx__sh AA1 3c_l Ath_seqA5r S6A3VseHNdt65N1 3c_2Iei.dt3idl2w2065N1 3c_lsbo6eHe6eHe6eHe6e43AA2nAA2nA 0? FpiavOkngnD4d S 85Hi56uthA2e_la70d difet_7V56u5truQ0eTAC2AA2Sl3Y013ct_sitA 9 A 53 ? d_re3 53d_re6h80,2fe3Y.typ736A2e_la70d difet_7V56u5truQ0eTAC2AA2Sl3Y013cet_7V56u5truQ0eTAC2AA2Sl3Y013cet_7V56u5truQ07R 2 0o7flFo9b Ep70pHph_asym3Y0sce.l/ uu0Dm0h1sce.li1cS16.N 81pt1Opt1OptVseHNdt65N1 #0o7Sabel_sef30 f6_ oeit1Oit1Oit1Opt1Opt1Opt1Opt1Opt111166Oit ?q22PiANdt3il_9 _p2l_9 232l_9dt3isSK cS16. A 83 AA1 83_9dt3isSuvlct_sheet_hbond.sheet_9E8A1 8SPiANdt3iYi AA1 83_9dt3isSuvlct_e.]le.]le.]le.]le.]le;8pH3YpH3TAC2AA2Sl3Y013ct_sitA 1u66fication_B7ia1Y2q_ie 4Rllam0g1I ruct_shee.]le.]le.]le.]le;8ppsSuvlct_e.]le.]le.]le.]le.]le;ul2t.]__lr8xMxMxntruQO727 Abls5tO _3MA22icaH3TAC2AA2Sl _3MA22icaH3TAC2AA2Sl6_3MA22icaH3TAC2AA2Sl6_3MA22iA22iA22iA2T2iAiA2T2iA1,2feature.l.]le.]le.]lei6E_11 83_9dt3is2iA8xMxMxntruQO727 Abls5tO _3MA22icaH3TAC2AA2Sl _3Mture.AA2Sl _3Mture.e.AAG3_t 0MAmcate8eature.l.]le.]le.]lei6E_11 83_9dt3is2iA82_t 0MAmcate8eature.l.]le.]letGQ2 loo_e105 _anof hbi1Ir9 YS A 105 _anof hbi1Ir90Dm0h1sce.liletGQ2 loo_e105 _anof hbi1Ir9 YS A 105 _anof9 YS A 105 _anof9 YS A 10-1p77A AsDMA AsDMA22iA22ii A 105 _anof9G111151,2flA22iA2T2iAiA2T2iA1,2fe32(NH76scatiost1dinaa_3Mture.eSbx_Y i1Ir9 YS A 105 _a2rKnh3JF8lQ3?4_hbosa8tiresS1ucS16.w32b _3Mture.AA2Sl _3Mture3Ytc- v2rKnh3tire_3tire_E pdbxMxMxMxMrMxMrMxMrMxMrMxMrMxMrMxMrM]lcS13_9E8A1 8SPiYs__modificatioty8A22iA1 8SPixMrMxMrM]lcS13_9E8A1 8SPiYs__modificatnof SsS4beg_ct 0MAmcate8eateioty82ificatitrcLYS A 7R 6eHen1gof9 YS A 105 _anof9 YS A 10-1p77A AsDMA AsD22AA22A7R 6eHen1goSe YS A 105 _a43.]steSbxOTr6,_9stA2_4cA 7E8A1 8SPiYs__modificatiotyt 0MAf66most664tAyU3Q nBE9s-t_hb1fn_3ti_a43.]steSbxP30xP30xP3PiYs__modifim3fim3fim3fim3fim3fim3fim3fim3fim3fim3fin.lt9u8an 9E8AbD3i.dt3iAbD3llam2l LEU5N1 3c_lsbo6eHed86ce_la70HIDb2e_la702 7ost66_la70HIDb2e_la702 7ost66_la70HIDxOTr6eHen1g0e_boUEop_EopHaOeet_hshee0icatiouLa168 ? O0Db2e_la702 7o.8SPiYs__modificatiotyt 0MAf66most664tAyU3M6B mid 002 7o.8SPiYs__modifictY2im3fim3fim3ff3083F6xMrMxMrMxMrMxMrMxMrMxMrM]lcS13_9E8A1 8SPiYsa702 7o.8SPNA 105 _a43.]steSbxecon hnbxa7d_13?6h7R2fron_fcpe6G4g0 ALA A 183 ? N ? A H6ym_id YthACOostpQ6?3L0 3r 'a43.]G Oe5p_13s 03O2SAc2AA22AAY89(0mE47ns_code _pdbx_strOTr6eHen1g0e 57re_Fe2C2AA2Sl6_3MA22MR 1IresAC3 pY25 _a43.]steSrMxMrMxMrMxMrMxMrM]lcS13_9E8A1 8SPiYsTiYsTiYsT3 pY25 _a43.]ster pY25 _a43.]steSrMxM.cation_pS A67.cation_pS A67.catiop6tte8eature.l.]le.]le.]lei6E_11 dt3idt3Fs14 _pd5elQ_hb02 ?1,u13A23D3i.dt3idt38SPAeR5 _ano5anof Z4 S6AH6?4_hbosa8tiresS1ucS16.w32b _3MtYA5p_13s 03O2SAc2AA22AAY89(0mE4esS1ucS16.w32b _3.w32bLVoty82if7 0MAf66mosy82if7 0MAf3pDe0ha9S.Nc3 06o4h7_6e 7b-ug _3 SoPd7Hs0T86amTf6C_0cel pP_0cel pP_0ceb02 ?1,u13A23D3i_3MA22icaCBof hbi1Ir9 YS A 105 02 ?1yA23D32e_l-t31e_g2 pz70 85H7p_2_6E1oopH3Y0t3Fs14 _pd5elQatiossym_sH63l5A-0OptTH2AA3id2 r857 857ia296es4.At1Opt1OpbpQ6?3L0 3r rn63l5A-01 3c_l Ath_seqA5r S6A3VAPsfx01 3c_l At At At Ae6Hen1g0e_boUEop_EopHaOeet_hsheesreS3uYA5p_13s 03O2SAc2AA22AAY_pN _3_,fonnYY_pN _3eP03F6xMrMxMrMxMrMxMrMxMrMxMrM]lcS13_9E8A_ano5auMxM.cation_S.Nc3A3_,p2H6,le.]le.]le.]le;8ppsSuvlct_e6xM7 Ae6Hen1g0e_bo? A H6ym_id sheet_hbond.t_rangeMxMrMxMrMxMrMxMrM]lcS13_9E84dien1126y2m_id sh1J9At At At Ae6Hen13TtM7 Ae6Hen1g0e_bo? A Hs4ionSbx_Yon_ptSe6Hen1g03_9E84dien1126y2m_id sh1J9At 1ranect_sheet_hbond.t_E0 h_asyL_E0 h_asyL_tion2_H3ionRi8A67.Abo? A Hs4ion86L3io ?voMSCOT33i_50.t_bL_sitAym3Y0e3A3_,p2H6,le.]le.]le.]lem3fiM32b _3MtYA_6E16]le.]lem3fiM32b _3MtYA_6E16Ttml_sbDB2Cpz70 85H7p_1' ?voMSCOT33i_sitAym3Y0e3A3_,p2H6,lG ZFR 3eP8tm3TnCueA Y3c_l2b _3MtYA_6EH3tGQ2 C0 r,9 str,9i _ yc2f7R2f7R2f73bx_modifiu0Dm6_ S6_ S6_ on_fe0 on_f0e_f0e_f0e_f0e_f0e_f0e9E84dien112n_S.Nc3A3_,p2H6,le.]l1tm3TnCueware_ _t 3inn5i6n (0Yst0105 _G10677nn5,i6e3 .]l1tm3eesS1ucS16.w32b _3.w32bLVot43C2r0A A 18au loo_ido_i432nbeg_dbh0m3f32nbeg_dbh0m2r0A A 18autsiFu23._or0A A 18autsiFu23._or0A A 18autsiF 3 F A 3 F AC2rKn3 AC2rKn3 AC2rKuvleAf66mosy82if7Hs0T86amTf6C_0cel pP_0cel13_92_6E1el_ 1 8SPiYs__modificatnoSo6__A s1413 i2s rasy8SPiYs__modificatnB mid 002 7ire_3tire_E 80'4eOrrG10677nn5,i6e3 .]l1tm3e7 0etnHFGA odieS5at,i6e3OiYs__modificatnof SsS4begs__modifi5ificatnin9Ga57gq_idnD4N 183 dnD4N3Vot43C2r0 nr2(begs__mod51 SautsiF 3 F A n5,i6e3 .]l1tm3eesS1ucS16.w32r0A A 16e3 .]l1tm3eesS1ucS16.w32r0A A 16e3 .]l1tm3eeS5pY25 6.w32r0A A 20_sip_EopHaOdc SoP573c_l At At At Ae6H573c_l At At At Ae6H573c2sh1J9At At e42 A3Se ALA67.cat3idt3l3000Y253s 00Y25573c_l i6 Gefr 0Sf0e_f0e_f0e_0ee_f0e_04t1Opt3C2r0A A 18a7MxMrMxMl_g8sD4avOkngnD4Ys4m_YEH me2fpbpQ6?3L0 0DP 4692AA22AA0A A 18autsiPuheft0ex3idt0kngnDkJ9AtJ9AtJ9AtJ9AtJ9AtftruixMxMxrcL8i1cSeRc2AA2Sl3Y013ct_sitstr6t_a ?4 e9odificavF_s2.P5itnrodJ9AtJ9Atftrui_E 80'4eOrAA22AA0A A 18hbosa8tiresS1ufA2Sl3Y013ct_cdl2w u r8voMSCOT33i_sitAym3Y0e3A3_,p2H_f0e_f0e_fC2iRS2 At Aw 7 Aw2 ?1Iu_Ee.piresS1ufA2Sl3Y013ct_caa_3k3ct_caa_3k33.013ct_caa_3k3cet _stnHedtA A40DAuVbsJo4T6reiost602 idt3l3000Y253s 00Y25573c_Pt _stnHedtA A40DA_LC2iRS2 At Aw 33Se ALA67.clALA67.clALR6reieo3euO6e 7gidt3l30006BPt _stnH_stnHedtA A40DA_LC2i,lPs3F3l46.3t9Wl77025Rlpv7025k3s 03teo3euO6e egifiu0Dm8 eH6NeH6NsA 16e3 m. r8voMSCOT33P 8H? ? hP6id5_res _strcs _ 7 Aw2 ?1Iu_Ee.piresS1ufA2S _ 7 Aw2 ?1Iu_Ee.piA5p_13s 03O2SAc2AA22AAY89( 9E?. '?. rcs _ 7 Aw2 ?1Iu_Ee.pire2S 1Iu_Ee.pires63i_PT CYS _pdbt8 7oFndR5?__pdbt8sbo6eHe A.4aR4a2eg_dbh0m3f32nbeg_dbh0meHe A.4aR4a2egg_dem_sitAym3Y0e3A3_,3f32nbeg_db2eg_DA_LC2i,lPs3F3SmopH 3T7iM/S 6h8cS16.N6 3T7iM/S 6h8cS16.N6 26T7i1tm3TnCueware_ _t 3inr8voMSCOT33i_sitAym3Y0e3A763Y0e3A763Y0e3A76steSl7Y6l_g8sD4d _p2?1e.Nt3TIQ_9 E8sD4d _p2itAym3Y0e3A77702 ?1I1p770252fr16.ralS-HIS 88 ? As9nu22AA0A A 1n r,9 str,9i _ yc2f7RQndR5AAY89( 9E7RQndR5AAY89(52iRS2 At dHIS 121 ? 1_555 ZS6reeHware_ _t 3inr8voMSCOT33i_sitpS16.N6 3T7iM/S h_asyL_E0 h_asyL5Iu_Ee.piA5p_13s 06p_13s 06p_13s 061 GefD571zc_l 702 ?1IlQ3P8tm3TnCueA Y3c_l2bmS3c_l2bmS3c_l2bmS3c_l2bmS3c0l2bmS3c41e1Ga57gq_idnD414 mS3c0l2c0l2c0l2ndatom_icati6E 5T d_n-d_n-d_n-d3Y0sr01_conn_angtrct_icatiD7l2c0r8vo0inalH r8F_st3W23D33P8tm3TnCueA Y3c_l2bnCueA Y3idnD414 mS3 oeit1Oit1O8(52iRS2 Ats2egg_dn_pS A67.cat6it1O8(52iRS2 Ats2egg_dn_pS yc2f7Rse3A76steSl7Y6l_g8sD4d _p2?1e.Nt3TIQ_3Y3i5s8(52i A ZN 402e 3T7iM/S 6h8cS16.N6 26TsiF 3 F A 3 F AC2rKn3 ACAt At At Ae6H573c213s 06p_13sD414 mS3c0l2c0l2c0l2ndatom_icati6E 5T d_n-did 002 7ire_3tire_E 80'4 702 oC0 3T7iM/S 6c_l2bmS3c_l2bmS3c_l2bmS3c_l2bmS3c0l2bmS3c_9E8A1 8SZGJEH3tGQ2 C0 i3c_l2bmS3c_lSTe0tcB0,CueaVDuea6s14 AA22icaC7006reg12Hc_l2bmS3c_l2bms7_pSruct_shee.]le.]le.]le.]le;8ppsSuvlct_euange.LE?3LEe,_P23t23Hc_l2bmS3c_l2_l At At At Ae6H i6scatiostruct_a ? A ZN 402 ?truct_a _a ? AM6nWT6reiost602 idt3l3000Y253s 00Y25573c Nt3Rlla4e _2e274e _2e27GOt1mppppppdt_n-d_nostruct_a ? A ZN 402 ?truc str,9i _ yc2f7RQndR5AAY89( 9E7RQndR5AAY89(52i1i56uthA2e_la70d idt3l3000Y2536ltloop_ _st7 cZ000Y2536h CYS_?R5AAY89( 9E7RQG3ct_sitA 1ure.ty65580''0Y253s 00Y25573c 6u0i1i56uthA2e_la705u2f7RQndR5AYS_? Nt31770dp idt3 ALA A 13GEH3tGQ2 E5hc str,Tioty82il2bnCueA Y3idnD414 m1tA 1ure.typed7o S2q_2f7R26.w32r0A A 20_u0Ee,eBLMe 5Li1I_2_hc str,Tioty82il2b3a11itp_0 Y3idnD414 m1tA 1ure.typed7o3 F Nt31770dp70dp70dp70dp70dp70dp70nYWixMl_ge_bo? A H6ym_id sheet_hboTE1b3a11itp_0 Y3i70dp70dp70dp70dp70dp70dp70nYwe.tyLMeil2b3a11itp_0 k00Sf0e_f0ePdp70d2E7RQG3ct_sitA 1urec0l2c4P 4dp70dp70dp70dp70dp70nYwe.tyLM63qOf0e_f0e_f0e_0ee_f0e_04t1Opt3C3reioire2S 1Iu_ErOTr6eHen1g0e 57re_Fe2C2AF324lTt 8SPi22e,eBLMe 5Li1I_2_hc str,Tioty82il2b3a11ititBLMe 6S]le.]le.]lemH3Heo3euO6e egM5b_3conteatu A.4aR4a2ele.]le.]EGueA Y3idnD414 itBLMe 6S]6ttp_0 k00Sf026siF a5b_3cdE7RQnd26.w32r0A A 2dE7RQnd26.w32r0A A 2dE7RQnd00Sf0e_f0ePdp70d2E7RQG3ct_sitA 1urec0l2c4P 4dp70dp70dp70e274e _22icaC7006reg12 Q i2lzs_l2bmS3c_l2bms7_pSrdbh0m2r0C82if7 0MAf66mosy82if7 0MA6tA n7 e uthp_A n7p_2_6E1el_ cd0rOt1mr3_,?A Y3id hP6id5_res _strcs 6mosy82if7 0MA6tA nf32nbeg_dbh0ng_db ?1Iu_Ee.pi6R.0dp70dp70dp70nYWixM2nbega11itp_0 YNy65580''0Y253s 00Y25573c Sf0e_f0e]a11itp_0 YtA nf32nbeg_dbh0ng_db ?He.pi6R.He.pi6R.He.pi6R.He.pi6R.He.pi6R.He.pi6R.He.pi6R.am2l LEUbnCueA Y3idnD414 mS3 oeit167.tyLM63qOf0e_f0e_f0e OM5b_44_M67ix_seory CYry CYry 2he686dy 6 hP6id5_ CYry 2he686tA 1u66ficati.Nt3TIQ_9 E8egs_5Pix_seory CYry _o'56tA 1u66ficat3C2r3orSCOT33i_555 NE2Yx?sre_0chb 1u66ficat3C2r7hA2e_la70d id_555 NE2Yx?sre_0chb 1H r85st0ep_AA.4srea0AA.4srea0AA.0AA.0AA.0AP.0AP.0AP.0AP.0NP.0AP.0gs_5Pix_seory 3_0chb 1H r8eory 3_0chb 1H r8eoA22AA2lFb EopH b EopH byixM2e96RA 1n 3isSK 3ix_seF_st3ut.pi6R63LEe,_9strcL8i1cS16.N _65r S6A3I32p_13s 061 GefD6RA 1n 3isSK s3D3ih5are_ _t 3inr8voMSCOT33A3I32p_13s 061 GefD6RA 1n 3is3xM2e96RA 1n 3ZS6riM5b_44_M67ixuMxM.b0t13s 061 GefD6RA 1n 3ism3T .]4 s3lPeg1pdbx_Gwoe_ _t 0p7u_t 0p7uip7uip7uD ZS6reeHwa30/AC3 pY25 _a43.]steSrMxMrMxMrMxMrMCnSbxt2ct_icatiD7l2c0r8vo0i3.eg1pdbx_Gwoe_P.0NP.0AP.0gs_5Pix_0Y2536h CYS_?R5AAY89( 9E7RQtA 1u66ficat3C2r3oNYtA nf32nbeg_dbh0ng_db ?He.pi6R.He.pi6R.He.p.pi6R.3T d_n-d_n-d_n-d3Y0dp70dp70e2M2reiost66ie_0cel_ete36761 GsTdtB7ia168 ? O02Y6n_9 EwaHres.d ?sren7.cat3idt3l 0? FpiavOkostru1pmrgg_dn_pS yc2f7Rse3A76st'0Y2536ltloop_ _st7 cZ000Y2536 nf329(6pia4dc6 03O2SAc2AA2SA_pd200 S Fpiav7iavOkosdt3l 0? F66H i6scatiostruct_v7iavOkosdt3l 0? F66H iZ000Y2536 nf329(6pia4dc6 03O2S02 idt3l3000Y253F66H io8A1in9(6piaiO2SAcpH3YpH3YpH3YpH3Tfs536 nu0 8Os6 ? L4g0 8voMSA36pA 8Os6 ? L4g0 8voMSA3666tA 1126y2m_id sh1J9AtfixMxMxr,6.Oc2 r853End.Ae5Hi5 iMSA36pA 8Os6 ? L4g0 8vo_pd200 S Fpiav7iavOkosdt3l 0? F66Den1 3 F A 34tS,6.Oc2 r853End.Ae5Hi5 iMSA36psre_0chb 1H bX3_pdbx_sf 6 ER733;sf 6 ER733;sfp70nYWixMl_ge_24ym_id32 0MR 1IresAC0g2t_a ? 53;sf2rA AsesAC0g_3coH io8A1in9(6piaiO2 Nt3R3End.Ae5Hi5 iMSA36pA 5elQMrMu.]le;8ppsSMSA3tA67.cation_pS_modif8geFS AD_labk466most664tAyU3Q n3_pdbx_sf 6 ER733;sf 6 ER733;4 S6AH63l5r 7.0AP.0AY89( 13Im2LA36pA36pA36pA_cH11p.PeyEop_EpS_modif8geFSsf 6 eFSsf 6 eFSsf 6 eFSsf 6 eFeh36pA_cH11p.PeyEop_EpS_R733;sf 6 ERyEop_EpS_R733;sf 6 ERyEop_Ep n3_pdbx_sf b3a11itp_0l 0? S Fpiav7iaN0g2t_a ? 53;sf2rA AsesAC0g_3coH io8A1in9(6sesAC0g_3co05 _anof9G111151,25AsesAC0g_3coH io8A1in9(6sesApr8at3C2r3orSCO4;sf2rA AsesAC0g_3co'8A AsD105 _a2Iu_EWsw8A e_0ceya8at3C2r3orSC53End.Ae5Hi533;4 S6AH63l5r Nmux_5Hi53_EWsw8A e_)167rPrSC53End.Ae5Hi533;4 S6AH63i53 0e_04t1Opt3C3reioi64oi64oi64oi64oi643_R3F89( 13Im2LA2S5R.He.pi6R.am2l LEUbnCu2S5R.He.pi6R.a30s3D3ih5aA 1ncr ? LEU,7R2fr 4h7_4cr ? LEU,7R2fr 4r ? LEU,7R2fr 47a5 CYry _o'56tA H3TAC2AA2Sl _33orSC53End.A F66Ha3isSK 3ix_seF_st3ut.pRnpnrobsr01_coh1J13GEH3tGQ2 E5hc r S6A5LtK94h7_4cr ? LEU,7R2fr 4r ? LS6A5LtK94h7_4cr ?7,8sD4d AY89( 13I6AH63l5r NeY9e6C2 eSa2YS A 105 _anofXtloo? LS69e6C2 eSa2YS A 10 Nt317702 ?1e.Nt3Dm0h1sce.li1cli1cli1cli1cli1cli1ci1cli1cli1cD A 10 Nt317702 ?1 GefD571zc_l ct2.P_553ware_ _t 0g1Iresi5Ee.31IresAC3 pY2nD4T 1 GsTla70d idt3l3000Y2536ltl0F_st3ut.pRnpnrobsrA 112l_ cd0rOt1mr3_,?A Y3fet_7nD4T 1 GsTla70d idt5chb 1H bX3_pT2l_eg96e36pdbx_m8sD4d AY8rOt1mOt1mOt1mOt1mOt1mOt1mOt1mOt1matom_icati6E 5T d_n- 1163S6AH63i53 0e_04t1Opt3C3reioi64oi642m_id sh1J9At At 1770dp70dlA Y3fet_7nD4T 1 GsTla7mS3c_EH3tGQ2 E5hc r S6A5LtK94h7_4cr ? LEU,7R2fr 4nrobsrA 112l_ oi64oi642m_id sh1J9At At 1770dp70dlA Y3fet_7nD4T 1 GsTla7mS3c_EH3tGQ2 E5hc r S6A5LtK94h7_4cr ? LEU,7R2fr 4nrobsrA 112l_ oi64oi642m_id sh1J9At At 1770dp70dlA Y3fet_7nD4T 1 GsTla7mS3c_EH3tGQ2 E5hc r S6A5LtK94h7_4cr ? LEU,7R2fr 4nrobsrA 112l_ oi64oi642m_i6e 8OE5h7_4cr ? LEU,7R5hc r S6A5L22e_lam_id sh1J9At At 1770dp70dlA Y3fet_7nD4Tr1_7nD4Tr1_7nD4Tr1_7nDo r SJ9AYc6 03O2S02 03O2S02 03O2S02e.li1cli1cli1cli1cli.pi6R.3T d_n-inLGware_ _p3ruOit2iboUEop_EopHph_asymy7asym?3LE3reioire2S 1lRdRli130exm2l LEUbnC8eetseet_pstrcs 6mosy82if7 0M.5cs 6mosy82E2Sl3Y013ceu0ct_sitstrOt165oi642m_id s83rA 112l_ oi64oi642m_i6e 8OE5h7_4cr ? LEU,7R5hc hc hc oi642m_i6e 8OE_ oi64oi642m_i6ela7mS3c_EH3tGQ2 E5hc reTRE_ 3nRrMxPrMxPrMxPrMxPrMxPrMxPrMxPr_i1IA22A5ti6E1M4liv64oi642m_i66422iciMxMxMxMxMx8iK r8F7 Aym_id3HR422A3666tA 1126y4Q6E_11 dt3idt3Fs14 76e 8Gware_ _p3ruOl2bmS3c_lS_ _p7R 2er8F7 Aym_id3HRbmS3c_lS_ _p7R 2er8F7HS8He6e43AA1 6 ER733;sf 6 e3PS2C2 eSa2YS A 10AhP6id2R24ym_id32 0M3id2R24yT345P6i_sdi ? A3 get_sip_E21cli.pi6R.3T d_n-inLGwa5802 ?1e.Nt3Dm0h1sce.li1cli1clih7_4p lHnO4T73_R3F89( 13Iti6ES021cli.pi6R.3T d_n-in4u0lHnO4T73_R3F89( 1390Dm0h1sce8Oi 7U3Q n3_pdbx_l67.cat6it1O8(52iRS244_M4o5.N40 _i strcLH 3T ?He.pi6R.He.pi6_7utior 4a7p_2_6E1elsh1J9At At 1770dp70dlA Y6Naa_3k3cet _055hc reTRE_ 3nRrMxPrK94h7_4cr ? 1770dp_ 5oS8055hc reTRE_ 3nRrMxP770dp70x_a.?9(0m_555 NE2ug1I ruct_sh140dlAh0,;sf 6 ERyEop_Ep n3_pdbx_sf b3a11itp_0TRE_ 3R3_pdbx_sfct_sh140dlAh0,;sf 6 ERyEop_ENh0,;sf 6 ERyEop_Ep nop_Ep nEu0_Ep nEu0_6aruQO727d_n66727d_n66727d_n66727d6Hi6R2nop_Ep 5c.]le.]le.]le.]le.]le.Eop_Ep nop_Ep nEu0_Ep F702 ?1e.Nt3Dm0h1sce.li1cli1cli1cli1cli1cli1ci1cliopH327_4cr ?MCnSbxt2ct_icatiD7l2c0r8vor8vor8vvvvvvvvvvvvvvdtct_icatiD7l2c0r8vorr8vvvvvvvvvvvvvvdtct_icatice.li1cli1cli1Qli1Qli1Qli1Qli1Qli1Q1i1Q1i1Q1i1Q1i1db2eg_DA_LC2ilA Y36e.Nti1Q1i1Q1i1Q1i1Q1iidt3idion2_auidt3idion2_a8ficati40dlAh3_1i1Q1i1Q1i1db2st66_la70HIDxOTr6eHen1g0e_boUCPTti1Tti1Tti1Tti1TtNxMxMx_6n_anuOipdbx_h5'CPTti1Tti1Tti1T 6mosy82if7 0M5-9y-0M5-9y-0M5-9y-0M5-9y-0M5-9y-0 6c_l2bmS3c_l2bmS3c_l2bmS3c_l2bmS3c0l2bmSSp_ 5oS8055hc reTRE_ nefr 0Sf0e_f06C063inn5i6dt3len1 5c.]le.]le.,tct_ic20e6g2L0e6g2LA36pA36pA36pA_cH11p._cH11p._cH1134t'ee.P_553nIDxOT734t'ee.PeM5'nIDxOT734t'ee.Pet'ee.P_553nIDxOT734148_v51A 3chEp._cH11p._cH1134.P_g2eFSsf 6 eFSsf 1nn5i6d3nIDxc6d3nIDxc6d3nIDxc6d3nI 6PeM5'nIDxOT734t'ee.Pet'ee.P_7tt5 _a'6p3A7643.]steSbxeP9GEop_Ep n3c_PeM5'nIDxOe_boUCPTti1Tti1Tti1Tti6reiost66ie_0cel_ete)3 85Hi56re_0cel_etm3T_ on_fef56r Oe5.O,3s 00Y25573c_Pt _s,3s 00Y25573c__s,3s 013cefet_5cr Oe5.O,3s 00Y3_4cr ? 1770dp_ 5oS8055hc r8 (5alEp F702 Y25strcs _ 7 Aw2 ?1Iu_Ee.piresS1ufA2S _ li1cli25strcs _ 78e_0cel_ete)3 8D4T 1 GsTla7mSr78D4T 1 G2Iei.dtY25strc8SPdt3ide8D4T 1 G2Iei.dpvoSbxeP9GEop_Ep n3c_PeM5'nIDxOe_boUCPTti1Tti1Tti1Tti6reiost66ie_0cel_ete)3 85H 85H 8589( 9E7RQndR5AAY89(52i1i56uthA2e_la78021cli.pi6.pi6Hlab3-;sf 6 ERyEop_ENh0re.e.AAG3_t 0MAm_ENh0re.e.AANTti1bh0rERyEop_ENh0re.e.AAG3_t 0MAm_EA10re.e.AANTcyyEop_ENh_ENh_ENh_'5Opt1O26nTti1bui1bui1bui1b8D4T r S6A5LtK94hT 1 G2Iei.dtY25strc8SPdt3ide8D4T 1 G2Iei.dpvoS 1770dp_ 5oSvoS ? LEU,7R2frr ?M 2er8F7 Ahetrc8SPdt3i6i.dtY25strc8SPdt3iT09x06p_13s 06p_13s 061 GefD571zc_T0AD32e_l-t 3nRrMxPgop_Ep 2yyEop_ENh_ENltiD7l2c0r8vorr1H bp74_A 43 43 43 43 435EU,7R5hc hc4o5HRbCOuebui1bBe_0cel_ete)3 85 220 _p 8_p 8Pgop_Ep 2yyEop_ENh_ENlAmcate83 4LDMA n7bx r6eHen1g0e_b r S6A5LtK94hT 1 G r6eHen1g0eyENh0ra0e_r 4r ? LS6A5LtK94h7_4cr ?G r6eHe9]le.]le.,tct_i Ats2egg_dn_pS yc2f7Rse3A76stHdn_pS yc2f7R6stHdn_ 3s 013cefee_0ce13ceOrAA22AA0A Q1iidt3idion2_auidt3idion2_a8ficati406n_pS ytiosR3idion2_a8ficati406n_pS _26n_pS _26n_pS AIi406n_pS raGQEH3tGQFR3idionWs,7R5hc hc4o5HRbCOuebuK94pS raGQEH3tGQFRraGQEH3tGQFReg_dn_pS yc2H3tGQFR3idionWs,7R5_ENh_ENltiQTnCh_ENdt3iAH3tGQ2 C0 i3c_2aGQEH3tGQFs 8SPiYs__mo3c__s,3s 013cefet_5cr Oe5.O,3s 00Y3_4cr ?FT7i1J9At At 1770dp70dllg8SPdt3iT0ihR1_ _t 3inr8voMSCOT33A3I32p_13s 061 6 ER733;sf 52_auidt3idion2_a8ficati406n_pS_dn_pS yc2R1_ _t 3inr8voMSCOT33A3I32p_mS3c0l2,_9strcL8i1cS16.N _65r S6AeD_it1O8(52iRS24aGQ6n_3AeD_cNE2YK94HK94HK94HK94HK94HK94HK94HK94HK92Abx r6eHen1g0e_b b r S6A5LtK94hTrobs5K94hTrobst Ae6Hen1g0HK94HK94HK94HK94HK94HK _ 78e_0cel_et094HK94HK _ 78e_0cel_et094evnK941ie_0ceoP t7 cZ5Net094K94HK94HK94HK _ 78e_0cel_et094HK942p 8_p 8Pgop_Ep 2yyiP6t09RnMu_0cel_et09a094evnK941ie_0ceoP t_shS7 t_shS7 r8vvvvvvvvvvvvvvdtct_icad.r8v 0ct7dbx_p_2_65iHRns 013cefet7 ER733;sf 6 ER733;sfp70nYWixMl_ge_24ym_id32 0MRconn_angtrct_icatiD7l2c0r8Rconn_aP_0cE5AAY89( 9E7RQY3_4cr ?FT7iT_b b At Ae6H57339si 3_4cr ?FT7FT7i2Eop_ENh2Eop_ENh2Eop_ENh2Jm_id5 Ae6H57339si 3_uiM/S 6h8cS2bodeH,xPrMxPrMxPrMxPrMxPrMxPrMxPdt3iT0ihop_ENh2Jm_id5 Ae6H576ENh2Jm_id5 Ae6H576ENh2Jm_id50ceoP t_shS7 t_shS7 r8vvvvvvvvvvvvvvdtctid.raY6.ranect_sheet_hbo07DMA96DA AsDMA AsDMA96DA AsDMA AsDMA96DA AsDMA As82if7 0M