data_2OON # _entry.id 2OON # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2OON pdb_00002oon 10.2210/pdb2oon/pdb RCSB RCSB041395 ? ? WWPDB D_1000041395 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-12-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-10-20 4 'Structure model' 1 3 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2OON _pdbx_database_status.recvd_initial_deposition_date 2007-01-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1RUU 'PYY in micellar (DPC) solution' unspecified PDB 1RU5 'PYY in aqueous solution' unspecified PDB 2OOO 'Refined Structure of PYY in water' unspecified PDB 2OOP 'Structure of Tyr7-PYY in solution' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zerbe, O.' 1 'Neumoin, A.' 2 'Mares, J.' 3 # _citation.id primary _citation.title ;Probing the formation of stable tertiary structure in a model miniprotein at atomic resolution: determinants of stability of a helical hairpin. ; _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 129 _citation.page_first 8811 _citation.page_last 8817 _citation.year 2007 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17580866 _citation.pdbx_database_id_DOI 10.1021/ja0716960 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Neumoin, A.' 1 ? primary 'Mares, J.' 2 ? primary 'Lerch-Bader, M.' 3 ? primary 'Bader, R.' 4 ? primary 'Zerbe, O.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Peptide YY' _entity.formula_weight 4219.653 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation P14A _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PYY, Peptide tyrosine tyrosine' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'YPAKPEAPGEDASAEELSRYYASLRHYLNLVTRQRY(NH2)' _entity_poly.pdbx_seq_one_letter_code_can YPAKPEAPGEDASAEELSRYYASLRHYLNLVTRQRYX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 PRO n 1 3 ALA n 1 4 LYS n 1 5 PRO n 1 6 GLU n 1 7 ALA n 1 8 PRO n 1 9 GLY n 1 10 GLU n 1 11 ASP n 1 12 ALA n 1 13 SER n 1 14 ALA n 1 15 GLU n 1 16 GLU n 1 17 LEU n 1 18 SER n 1 19 ARG n 1 20 TYR n 1 21 TYR n 1 22 ALA n 1 23 SER n 1 24 LEU n 1 25 ARG n 1 26 HIS n 1 27 TYR n 1 28 LEU n 1 29 ASN n 1 30 LEU n 1 31 VAL n 1 32 THR n 1 33 ARG n 1 34 GLN n 1 35 ARG n 1 36 TYR n 1 37 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name pig _entity_src_gen.gene_src_genus Sus _entity_src_gen.pdbx_gene_src_gene PYY _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sus scrofa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain DH5a _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 1 1 TYR TYR A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 NH2 37 37 37 NH2 NH2 A . n # _exptl.entry_id 2OON _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2OON _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2OON _struct.title 'Structure of Ala14-PYY in aqueous solution' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2OON _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'peptide YY, PYY, neurohormone, folding of helical hairpins, HORMONE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYY_PIG _struct_ref.pdbx_db_accession P68005 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2OON _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P68005 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 36 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 36 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2OON _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 14 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P68005 _struct_ref_seq_dif.db_mon_id PRO _struct_ref_seq_dif.pdbx_seq_db_seq_num 14 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 14 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 15 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 30 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 15 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 30 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id TYR _struct_conn.ptnr1_label_seq_id 36 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 37 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id TYR _struct_conn.ptnr1_auth_seq_id 36 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 37 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.320 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 3 ? ? 56.24 90.11 2 1 LYS A 4 ? ? 52.82 87.36 3 1 ALA A 7 ? ? -153.87 84.30 4 1 ASP A 11 ? ? -152.31 55.24 5 1 THR A 32 ? ? -85.42 -129.28 6 2 LYS A 4 ? ? 37.89 80.44 7 2 ALA A 7 ? ? -159.29 80.07 8 2 ASP A 11 ? ? -152.05 71.59 9 2 THR A 32 ? ? -82.31 -122.43 10 3 GLU A 6 ? ? -179.50 133.61 11 3 ALA A 7 ? ? -155.67 89.01 12 3 ASP A 11 ? ? -152.64 65.46 13 3 ALA A 12 ? ? -171.22 140.45 14 3 THR A 32 ? ? -83.00 -157.87 15 3 ARG A 33 ? ? -111.38 51.22 16 4 ALA A 3 ? ? 66.09 162.66 17 4 LYS A 4 ? ? -45.84 97.32 18 4 ASP A 11 ? ? -155.67 71.21 19 4 GLN A 34 ? ? -124.90 -57.37 20 5 ALA A 7 ? ? -156.21 86.83 21 5 ASP A 11 ? ? -151.59 63.66 22 5 THR A 32 ? ? -123.94 -165.98 23 5 ARG A 35 ? ? 47.34 78.95 24 6 ALA A 3 ? ? 69.77 129.03 25 6 GLU A 6 ? ? -174.94 140.00 26 6 ASP A 11 ? ? -152.65 73.59 27 6 ALA A 12 ? ? -171.82 134.44 28 6 THR A 32 ? ? -87.84 -115.59 29 6 GLN A 34 ? ? -62.68 89.72 30 6 ARG A 35 ? ? -45.13 108.26 31 7 ASP A 11 ? ? 55.61 73.24 32 7 ALA A 12 ? ? -69.00 63.27 33 7 THR A 32 ? ? -83.92 -119.27 34 8 ALA A 3 ? ? 70.29 174.51 35 8 LYS A 4 ? ? -43.48 102.40 36 8 GLU A 6 ? ? -172.08 138.10 37 8 ALA A 7 ? ? -168.13 86.27 38 8 VAL A 31 ? ? -118.98 -94.97 39 9 GLU A 6 ? ? -177.98 132.23 40 9 ALA A 7 ? ? -165.95 93.11 41 9 ASP A 11 ? ? -149.83 53.15 42 9 GLN A 34 ? ? 65.73 -52.85 43 9 ARG A 35 ? ? 56.16 87.76 44 10 ALA A 3 ? ? -152.46 83.97 45 10 GLU A 6 ? ? 172.50 163.87 46 10 ALA A 7 ? ? 72.28 79.66 47 10 ASP A 11 ? ? -151.14 27.71 48 10 GLN A 34 ? ? 56.02 -177.20 49 11 LYS A 4 ? ? -46.89 150.08 50 11 ALA A 7 ? ? -155.63 83.82 51 11 ASP A 11 ? ? -152.94 72.14 52 11 VAL A 31 ? ? -120.02 -97.45 53 11 THR A 32 ? ? -73.59 -167.21 54 11 ARG A 33 ? ? 82.87 -40.84 55 12 ALA A 7 ? ? 77.52 153.94 56 12 ASP A 11 ? ? -157.64 72.62 57 12 ALA A 12 ? ? 172.40 135.48 58 12 GLN A 34 ? ? 56.82 162.55 59 12 ARG A 35 ? ? 47.07 87.13 60 13 LYS A 4 ? ? -45.58 98.09 61 13 GLU A 6 ? ? -177.49 135.83 62 13 ALA A 7 ? ? -153.03 88.13 63 13 ALA A 12 ? ? -177.24 139.20 64 13 ARG A 35 ? ? -51.65 99.51 65 14 GLU A 6 ? ? -177.26 133.10 66 14 ALA A 7 ? ? -160.36 71.08 67 14 GLU A 10 ? ? 47.45 18.48 68 14 ASP A 11 ? ? -156.65 15.87 69 14 ALA A 12 ? ? -179.32 140.15 70 14 GLN A 34 ? ? 60.11 -175.22 71 15 LYS A 4 ? ? 45.35 79.59 72 15 GLU A 6 ? ? 169.34 148.68 73 15 ALA A 7 ? ? -164.32 89.04 74 15 ASP A 11 ? ? -155.73 69.96 75 15 ARG A 35 ? ? 62.49 81.09 76 16 GLU A 6 ? ? 165.01 150.57 77 16 GLU A 10 ? ? 76.64 35.72 78 16 ASP A 11 ? ? 59.71 70.76 79 16 THR A 32 ? ? -93.73 -159.88 80 16 ARG A 33 ? ? -106.72 44.67 81 17 ALA A 3 ? ? 70.12 -179.93 82 17 ALA A 7 ? ? 69.14 148.58 83 17 ASP A 11 ? ? -151.20 44.17 84 17 THR A 32 ? ? -58.57 177.30 85 17 ARG A 35 ? ? 52.09 -177.91 86 18 GLU A 6 ? ? 71.21 141.12 87 18 ASP A 11 ? ? -155.15 74.56 88 18 THR A 32 ? ? -84.53 -110.53 89 18 GLN A 34 ? ? -57.94 100.01 90 18 ARG A 35 ? ? -57.17 96.12 91 19 ALA A 3 ? ? -169.91 72.67 92 19 LYS A 4 ? ? -163.34 97.35 93 19 ALA A 7 ? ? -148.96 56.92 94 19 GLN A 34 ? ? 53.81 -91.73 95 20 GLU A 10 ? ? 77.41 32.95 96 20 ASP A 11 ? ? 60.62 69.92 97 20 ALA A 12 ? ? -67.83 74.31 # _pdbx_nmr_ensemble.entry_id 2OON _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2OON _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2mM solution at pH 4.1 in 20mM acetate buffer' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 301 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 '2D TOCSY' 1 3 1 DQF-COSY 1 # _pdbx_nmr_refine.entry_id 2OON _pdbx_nmr_refine.method 'AMBER energy minimization in explicit water' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' DYANA 1.5 Guentert 1 processing UXNMR 1.3 Bruker 2 refinement Amber 6 Kollman 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 LEU N N N N 144 LEU CA C N S 145 LEU C C N N 146 LEU O O N N 147 LEU CB C N N 148 LEU CG C N N 149 LEU CD1 C N N 150 LEU CD2 C N N 151 LEU OXT O N N 152 LEU H H N N 153 LEU H2 H N N 154 LEU HA H N N 155 LEU HB2 H N N 156 LEU HB3 H N N 157 LEU HG H N N 158 LEU HD11 H N N 159 LEU HD12 H N N 160 LEU HD13 H N N 161 LEU HD21 H N N 162 LEU HD22 H N N 163 LEU HD23 H N N 164 LEU HXT H N N 165 LYS N N N N 166 LYS CA C N S 167 LYS C C N N 168 LYS O O N N 169 LYS CB C N N 170 LYS CG C N N 171 LYS CD C N N 172 LYS CE C N N 173 LYS NZ N N N 174 LYS OXT O N N 175 LYS H H N N 176 LYS H2 H N N 177 LYS HA H N N 178 LYS HB2 H N N 179 LYS HB3 H N N 180 LYS HG2 H N N 181 LYS HG3 H N N 182 LYS HD2 H N N 183 LYS HD3 H N N 184 LYS HE2 H N N 185 LYS HE3 H N N 186 LYS HZ1 H N N 187 LYS HZ2 H N N 188 LYS HZ3 H N N 189 LYS HXT H N N 190 NH2 N N N N 191 NH2 HN1 H N N 192 NH2 HN2 H N N 193 PRO N N N N 194 PRO CA C N S 195 PRO C C N N 196 PRO O O N N 197 PRO CB C N N 198 PRO CG C N N 199 PRO CD C N N 200 PRO OXT O N N 201 PRO H H N N 202 PRO HA H N N 203 PRO HB2 H N N 204 PRO HB3 H N N 205 PRO HG2 H N N 206 PRO HG3 H N N 207 PRO HD2 H N N 208 PRO HD3 H N N 209 PRO HXT H N N 210 SER N N N N 211 SER CA C N S 212 SER C C N N 213 SER O O N N 214 SER CB C N N 215 SER OG O N N 216 SER OXT O N N 217 SER H H N N 218 SER H2 H N N 219 SER HA H N N 220 SER HB2 H N N 221 SER HB3 H N N 222 SER HG H N N 223 SER HXT H N N 224 THR N N N N 225 THR CA C N S 226 THR C C N N 227 THR O O N N 228 THR CB C N R 229 THR OG1 O N N 230 THR CG2 C N N 231 THR OXT O N N 232 THR H H N N 233 THR H2 H N N 234 THR HA H N N 235 THR HB H N N 236 THR HG1 H N N 237 THR HG21 H N N 238 THR HG22 H N N 239 THR HG23 H N N 240 THR HXT H N N 241 TYR N N N N 242 TYR CA C N S 243 TYR C C N N 244 TYR O O N N 245 TYR CB C N N 246 TYR CG C Y N 247 TYR CD1 C Y N 248 TYR CD2 C Y N 249 TYR CE1 C Y N 250 TYR CE2 C Y N 251 TYR CZ C Y N 252 TYR OH O N N 253 TYR OXT O N N 254 TYR H H N N 255 TYR H2 H N N 256 TYR HA H N N 257 TYR HB2 H N N 258 TYR HB3 H N N 259 TYR HD1 H N N 260 TYR HD2 H N N 261 TYR HE1 H N N 262 TYR HE2 H N N 263 TYR HH H N N 264 TYR HXT H N N 265 VAL N N N N 266 VAL CA C N S 267 VAL C C N N 268 VAL O O N N 269 VAL CB C N N 270 VAL CG1 C N N 271 VAL CG2 C N N 272 VAL OXT O N N 273 VAL H H N N 274 VAL H2 H N N 275 VAL HA H N N 276 VAL HB H N N 277 VAL HG11 H N N 278 VAL HG12 H N N 279 VAL HG13 H N N 280 VAL HG21 H N N 281 VAL HG22 H N N 282 VAL HG23 H N N 283 VAL HXT H N N 284 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 NH2 N HN1 sing N N 182 NH2 N HN2 sing N N 183 PRO N CA sing N N 184 PRO N CD sing N N 185 PRO N H sing N N 186 PRO CA C sing N N 187 PRO CA CB sing N N 188 PRO CA HA sing N N 189 PRO C O doub N N 190 PRO C OXT sing N N 191 PRO CB CG sing N N 192 PRO CB HB2 sing N N 193 PRO CB HB3 sing N N 194 PRO CG CD sing N N 195 PRO CG HG2 sing N N 196 PRO CG HG3 sing N N 197 PRO CD HD2 sing N N 198 PRO CD HD3 sing N N 199 PRO OXT HXT sing N N 200 SER N CA sing N N 201 SER N H sing N N 202 SER N H2 sing N N 203 SER CA C sing N N 204 SER CA CB sing N N 205 SER CA HA sing N N 206 SER C O doub N N 207 SER C OXT sing N N 208 SER CB OG sing N N 209 SER CB HB2 sing N N 210 SER CB HB3 sing N N 211 SER OG HG sing N N 212 SER OXT HXT sing N N 213 THR N CA sing N N 214 THR N H sing N N 215 THR N H2 sing N N 216 THR CA C sing N N 217 THR CA CB sing N N 218 THR CA HA sing N N 219 THR C O doub N N 220 THR C OXT sing N N 221 THR CB OG1 sing N N 222 THR CB CG2 sing N N 223 THR CB HB sing N N 224 THR OG1 HG1 sing N N 225 THR CG2 HG21 sing N N 226 THR CG2 HG22 sing N N 227 THR CG2 HG23 sing N N 228 THR OXT HXT sing N N 229 TYR N CA sing N N 230 TYR N H sing N N 231 TYR N H2 sing N N 232 TYR CA C sing N N 233 TYR CA CB sing N N 234 TYR CA HA sing N N 235 TYR C O doub N N 236 TYR C OXT sing N N 237 TYR CB CG sing N N 238 TYR CB HB2 sing N N 239 TYR CB HB3 sing N N 240 TYR CG CD1 doub Y N 241 TYR CG CD2 sing Y N 242 TYR CD1 CE1 sing Y N 243 TYR CD1 HD1 sing N N 244 TYR CD2 CE2 doub Y N 245 TYR CD2 HD2 sing N N 246 TYR CE1 CZ doub Y N 247 TYR CE1 HE1 sing N N 248 TYR CE2 CZ sing Y N 249 TYR CE2 HE2 sing N N 250 TYR CZ OH sing N N 251 TYR OH HH sing N N 252 TYR OXT HXT sing N N 253 VAL N CA sing N N 254 VAL N H sing N N 255 VAL N H2 sing N N 256 VAL CA C sing N N 257 VAL CA CB sing N N 258 VAL CA HA sing N N 259 VAL C O doub N N 260 VAL C OXT sing N N 261 VAL CB CG1 sing N N 262 VAL CB CG2 sing N N 263 VAL CB HB sing N N 264 VAL CG1 HG11 sing N N 265 VAL CG1 HG12 sing N N 266 VAL CG1 HG13 sing N N 267 VAL CG2 HG21 sing N N 268 VAL CG2 HG22 sing N N 269 VAL CG2 HG23 sing N N 270 VAL OXT HXT sing N N 271 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2OON _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_