data_2OT2 # _entry.id 2OT2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2OT2 pdb_00002ot2 10.2210/pdb2ot2/pdb RCSB RCSB041550 ? ? WWPDB D_1000041550 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2OT2 _pdbx_database_status.recvd_initial_deposition_date 2007-02-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, L.' 1 'Jin, C.' 2 # _citation.id primary _citation.title 'Solution structure of Escherichia coli HypC' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 361 _citation.page_first 665 _citation.page_last 669 _citation.year 2007 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17669368 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2007.07.094 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, L.' 1 ? primary 'Xia, B.' 2 ? primary 'Jin, C.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hydrogenase isoenzymes formation protein hypC' _entity.formula_weight 9738.959 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAMSVINEAEARDTLDALQNMFDVEPD VGALLYGEEK ; _entity_poly.pdbx_seq_one_letter_code_can ;MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAMSVINEAEARDTLDALQNMFDVEPD VGALLYGEEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 CYS n 1 3 ILE n 1 4 GLY n 1 5 VAL n 1 6 PRO n 1 7 GLY n 1 8 GLN n 1 9 ILE n 1 10 ARG n 1 11 THR n 1 12 ILE n 1 13 ASP n 1 14 GLY n 1 15 ASN n 1 16 GLN n 1 17 ALA n 1 18 LYS n 1 19 VAL n 1 20 ASP n 1 21 VAL n 1 22 CYS n 1 23 GLY n 1 24 ILE n 1 25 GLN n 1 26 ARG n 1 27 ASP n 1 28 VAL n 1 29 ASP n 1 30 LEU n 1 31 THR n 1 32 LEU n 1 33 VAL n 1 34 GLY n 1 35 SER n 1 36 CYS n 1 37 ASP n 1 38 GLU n 1 39 ASN n 1 40 GLY n 1 41 GLN n 1 42 PRO n 1 43 ARG n 1 44 VAL n 1 45 GLY n 1 46 GLN n 1 47 TRP n 1 48 VAL n 1 49 LEU n 1 50 VAL n 1 51 HIS n 1 52 VAL n 1 53 GLY n 1 54 PHE n 1 55 ALA n 1 56 MET n 1 57 SER n 1 58 VAL n 1 59 ILE n 1 60 ASN n 1 61 GLU n 1 62 ALA n 1 63 GLU n 1 64 ALA n 1 65 ARG n 1 66 ASP n 1 67 THR n 1 68 LEU n 1 69 ASP n 1 70 ALA n 1 71 LEU n 1 72 GLN n 1 73 ASN n 1 74 MET n 1 75 PHE n 1 76 ASP n 1 77 VAL n 1 78 GLU n 1 79 PRO n 1 80 ASP n 1 81 VAL n 1 82 GLY n 1 83 ALA n 1 84 LEU n 1 85 LEU n 1 86 TYR n 1 87 GLY n 1 88 GLU n 1 89 GLU n 1 90 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene hypC _entity_src_gen.gene_src_species 'Escherichia coli' _entity_src_gen.gene_src_strain K-12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli K12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HYPC_ECOLI _struct_ref.pdbx_db_accession P0AAM3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAMSVINEAEARDTLDALQNMFDVEPD VGALLYGEEK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2OT2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 90 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AAM3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 90 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 90 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 60mM _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM HypC; 30mM phosphate buffer(pH 7.0); 20mM dithiothreitol; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 600 ? 2 AVANCE Bruker 800 ? 3 AVANCE Bruker 500 ? # _pdbx_nmr_refine.entry_id 2OT2 _pdbx_nmr_refine.method 'distance geometry, torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2OT2 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_ensemble.entry_id 2OT2 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2OT2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'data analysis' NMRPipe 1.0 'Delaglio, F.' 1 'data analysis' DYANA 2.0 'Guentert, P.' 2 refinement Amber ? ? 3 # _exptl.entry_id 2OT2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2OT2 _struct.title 'Solution Structure of HypC' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2OT2 _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text 'BETA BARREL, CHAPERONE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 60 ? VAL A 77 ? ASN A 60 VAL A 77 1 ? 18 HELX_P HELX_P2 2 PRO A 79 ? TYR A 86 ? PRO A 79 TYR A 86 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 4 ? ILE A 12 ? GLY A 4 ILE A 12 A 2 GLN A 16 ? ASP A 20 ? GLN A 16 ASP A 20 A 3 GLN A 25 ? ASP A 29 ? GLN A 25 ASP A 29 A 4 PHE A 54 ? ILE A 59 ? PHE A 54 ILE A 59 A 5 TRP A 47 ? HIS A 51 ? TRP A 47 HIS A 51 A 6 GLY A 4 ? ILE A 12 ? GLY A 4 ILE A 12 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 8 ? N GLN A 8 O ASP A 20 ? O ASP A 20 A 2 3 N VAL A 19 ? N VAL A 19 O ARG A 26 ? O ARG A 26 A 3 4 N ASP A 29 ? N ASP A 29 O ALA A 55 ? O ALA A 55 A 4 5 O MET A 56 ? O MET A 56 N LEU A 49 ? N LEU A 49 A 5 6 O VAL A 48 ? O VAL A 48 N GLY A 7 ? N GLY A 7 # _database_PDB_matrix.entry_id 2OT2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2OT2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LYS 90 90 90 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-04 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.53 2 3 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.56 3 4 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.58 4 5 OD2 A ASP 29 ? ? HG1 A THR 31 ? ? 1.56 5 6 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.59 6 7 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.55 7 8 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.54 8 9 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.56 9 10 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.57 10 11 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.57 11 12 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.57 12 13 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.55 13 15 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.55 14 16 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.57 15 17 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.56 16 18 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.55 17 19 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.60 18 20 OD1 A ASP 29 ? ? HG1 A THR 31 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 9 ? ? -68.47 79.97 2 1 LYS A 18 ? ? -114.48 78.25 3 1 PHE A 75 ? ? -140.86 -19.43 4 3 HIS A 51 ? ? -130.82 -60.08 5 3 PHE A 75 ? ? -133.44 -39.33 6 3 GLU A 89 ? ? 69.40 -59.88 7 4 ASN A 15 ? ? -68.33 9.24 8 4 VAL A 21 ? ? -90.07 59.81 9 4 CYS A 36 ? ? 56.40 177.52 10 4 PHE A 75 ? ? -141.65 -3.79 11 4 GLU A 78 ? ? 79.05 163.93 12 5 LEU A 30 ? ? -83.29 36.86 13 5 ASN A 73 ? ? -150.57 -34.07 14 5 GLU A 88 ? ? -143.62 51.48 15 6 LYS A 18 ? ? -113.58 75.97 16 6 VAL A 52 ? ? -157.81 63.12 17 6 VAL A 77 ? ? 71.73 -23.29 18 7 ASN A 15 ? ? -66.75 2.29 19 7 ARG A 43 ? ? -69.53 13.87 20 7 HIS A 51 ? ? -141.44 -39.05 21 7 ASP A 80 ? ? 47.09 -118.48 22 8 LYS A 18 ? ? -118.26 72.58 23 8 VAL A 21 ? ? -80.45 38.94 24 8 VAL A 52 ? ? 44.45 28.87 25 8 MET A 74 ? ? -78.18 32.07 26 8 ASP A 76 ? ? 47.51 26.87 27 9 HIS A 51 ? ? -137.12 -48.38 28 9 PHE A 75 ? ? -137.67 -44.88 29 11 LYS A 18 ? ? -110.46 77.72 30 11 VAL A 52 ? ? 59.77 -61.07 31 11 GLN A 72 ? ? -93.33 -66.21 32 11 TYR A 86 ? ? -152.12 -158.95 33 12 ASN A 15 ? ? -144.42 27.92 34 12 VAL A 52 ? ? 44.81 28.51 35 12 GLN A 72 ? ? -68.46 6.58 36 12 VAL A 81 ? ? 51.71 -6.08 37 13 LYS A 18 ? ? -104.62 69.60 38 13 GLU A 38 ? ? 176.07 -48.11 39 13 HIS A 51 ? ? -148.26 -45.85 40 13 VAL A 52 ? ? -126.97 -166.97 41 13 ALA A 83 ? ? 55.62 -2.08 42 14 SER A 35 ? ? 58.50 -14.28 43 14 VAL A 52 ? ? 44.10 28.45 44 15 CYS A 2 ? ? -78.32 47.36 45 15 ASN A 15 ? ? -69.37 2.04 46 15 LYS A 18 ? ? -115.82 73.09 47 15 VAL A 21 ? ? -82.56 43.08 48 15 CYS A 36 ? ? 61.97 145.48 49 16 ASN A 15 ? ? -74.09 22.48 50 16 LYS A 18 ? ? -110.79 78.37 51 16 ASN A 73 ? ? -147.76 -17.86 52 16 VAL A 81 ? ? -158.02 -35.10 53 17 VAL A 52 ? ? 56.37 -75.99 54 18 CYS A 2 ? ? -76.21 47.07 55 18 ASN A 15 ? ? -66.52 5.00 56 18 VAL A 52 ? ? 45.46 27.85 57 18 PHE A 75 ? ? -141.33 -41.60 58 18 PRO A 79 ? ? -74.93 31.29 59 19 ILE A 9 ? ? -69.94 93.30 60 19 CYS A 22 ? ? 38.42 45.95 61 19 ARG A 43 ? ? -74.21 20.99 62 19 HIS A 51 ? ? -144.07 -29.47 63 20 ARG A 43 ? ? -69.54 13.14 64 20 HIS A 51 ? ? -154.02 -32.83 65 20 GLU A 78 ? ? 81.89 141.11 66 20 VAL A 81 ? ? -132.33 -36.25 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 14 ARG A 26 ? ? 0.104 'SIDE CHAIN' 2 20 ARG A 10 ? ? 0.115 'SIDE CHAIN' #