data_2OT9 # _entry.id 2OT9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2OT9 RCSB RCSB041557 WWPDB D_1000041557 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC84959 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2OT9 _pdbx_database_status.recvd_initial_deposition_date 2007-02-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, R.' 1 'Clancy, S.' 2 'Joachimiak, A.' 3 'Midwest Center for Structural Genomics (MCSG)' 4 # _citation.id primary _citation.title 'The crystal structure of YaeQ protein from Pseudomonas syringae' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Wu, R.' 1 primary 'Clancy, S.' 2 primary 'Joachimiak, A.' 3 # _cell.entry_id 2OT9 _cell.length_a 40.311 _cell.length_b 61.405 _cell.length_c 77.828 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2OT9 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein' 20899.182 1 ? ? ? ? 2 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 3 non-polymer syn 'S,R MESO-TARTARIC ACID' 150.087 1 ? ? ? ? 4 water nat water 18.015 111 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MAQPSTTYKFELNLTDLDRGVYESVKQTIARHPSETEER(MSE)TVRLLAYAFWYNEQLAFGRGLSDVDEPALWEKSLDD RVLHWIEVGQPDADRLTWCSRRTERTSLLAYGSLRVWEGKVIPAIKNLKNVNIAAVPQDVLEVLAKD(MSE)PRVIKWDV (MSE)ISEGTVFVTDDRGQHEVQLQWLTGERG ; _entity_poly.pdbx_seq_one_letter_code_can ;MAQPSTTYKFELNLTDLDRGVYESVKQTIARHPSETEERMTVRLLAYAFWYNEQLAFGRGLSDVDEPALWEKSLDDRVLH WIEVGQPDADRLTWCSRRTERTSLLAYGSLRVWEGKVIPAIKNLKNVNIAAVPQDVLEVLAKDMPRVIKWDVMISEGTVF VTDDRGQHEVQLQWLTGERG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC84959 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLN n 1 4 PRO n 1 5 SER n 1 6 THR n 1 7 THR n 1 8 TYR n 1 9 LYS n 1 10 PHE n 1 11 GLU n 1 12 LEU n 1 13 ASN n 1 14 LEU n 1 15 THR n 1 16 ASP n 1 17 LEU n 1 18 ASP n 1 19 ARG n 1 20 GLY n 1 21 VAL n 1 22 TYR n 1 23 GLU n 1 24 SER n 1 25 VAL n 1 26 LYS n 1 27 GLN n 1 28 THR n 1 29 ILE n 1 30 ALA n 1 31 ARG n 1 32 HIS n 1 33 PRO n 1 34 SER n 1 35 GLU n 1 36 THR n 1 37 GLU n 1 38 GLU n 1 39 ARG n 1 40 MSE n 1 41 THR n 1 42 VAL n 1 43 ARG n 1 44 LEU n 1 45 LEU n 1 46 ALA n 1 47 TYR n 1 48 ALA n 1 49 PHE n 1 50 TRP n 1 51 TYR n 1 52 ASN n 1 53 GLU n 1 54 GLN n 1 55 LEU n 1 56 ALA n 1 57 PHE n 1 58 GLY n 1 59 ARG n 1 60 GLY n 1 61 LEU n 1 62 SER n 1 63 ASP n 1 64 VAL n 1 65 ASP n 1 66 GLU n 1 67 PRO n 1 68 ALA n 1 69 LEU n 1 70 TRP n 1 71 GLU n 1 72 LYS n 1 73 SER n 1 74 LEU n 1 75 ASP n 1 76 ASP n 1 77 ARG n 1 78 VAL n 1 79 LEU n 1 80 HIS n 1 81 TRP n 1 82 ILE n 1 83 GLU n 1 84 VAL n 1 85 GLY n 1 86 GLN n 1 87 PRO n 1 88 ASP n 1 89 ALA n 1 90 ASP n 1 91 ARG n 1 92 LEU n 1 93 THR n 1 94 TRP n 1 95 CYS n 1 96 SER n 1 97 ARG n 1 98 ARG n 1 99 THR n 1 100 GLU n 1 101 ARG n 1 102 THR n 1 103 SER n 1 104 LEU n 1 105 LEU n 1 106 ALA n 1 107 TYR n 1 108 GLY n 1 109 SER n 1 110 LEU n 1 111 ARG n 1 112 VAL n 1 113 TRP n 1 114 GLU n 1 115 GLY n 1 116 LYS n 1 117 VAL n 1 118 ILE n 1 119 PRO n 1 120 ALA n 1 121 ILE n 1 122 LYS n 1 123 ASN n 1 124 LEU n 1 125 LYS n 1 126 ASN n 1 127 VAL n 1 128 ASN n 1 129 ILE n 1 130 ALA n 1 131 ALA n 1 132 VAL n 1 133 PRO n 1 134 GLN n 1 135 ASP n 1 136 VAL n 1 137 LEU n 1 138 GLU n 1 139 VAL n 1 140 LEU n 1 141 ALA n 1 142 LYS n 1 143 ASP n 1 144 MSE n 1 145 PRO n 1 146 ARG n 1 147 VAL n 1 148 ILE n 1 149 LYS n 1 150 TRP n 1 151 ASP n 1 152 VAL n 1 153 MSE n 1 154 ILE n 1 155 SER n 1 156 GLU n 1 157 GLY n 1 158 THR n 1 159 VAL n 1 160 PHE n 1 161 VAL n 1 162 THR n 1 163 ASP n 1 164 ASP n 1 165 ARG n 1 166 GLY n 1 167 GLN n 1 168 HIS n 1 169 GLU n 1 170 VAL n 1 171 GLN n 1 172 LEU n 1 173 GLN n 1 174 TRP n 1 175 LEU n 1 176 THR n 1 177 GLY n 1 178 GLU n 1 179 ARG n 1 180 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene PSPTO_1487 _entity_src_gen.gene_src_species 'Pseudomonas syringae group genomosp. 3' _entity_src_gen.gene_src_strain DC3000 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas syringae pv. tomato' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 223283 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PDM68 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q886T9_PSESM _struct_ref.pdbx_db_accession Q886T9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAQPSTTYKFELNLTDLDRGVYESVKQTIARHPSETEERMTVRLLAYAFWYNEQLAFGRGLSDVDEPALWEKSLDDRVLH WIEVGQPDADRLTWCSRRTERTSLLAYGSLRVWEGKVIPAIKNLKNVNIAAVPQDVLEVLAKDMPRVIKWDVMISEGTVF VTDDRGQHEVQLQWLTGERG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2OT9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q886T9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 180 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 180 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2OT9 MSE A 40 ? UNP Q886T9 MET 40 'MODIFIED RESIDUE' 40 1 1 2OT9 MSE A 144 ? UNP Q886T9 MET 144 'MODIFIED RESIDUE' 144 2 1 2OT9 MSE A 153 ? UNP Q886T9 MET 153 'MODIFIED RESIDUE' 153 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SRT non-polymer . 'S,R MESO-TARTARIC ACID' ? 'C4 H6 O6' 150.087 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2OT9 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_percent_sol 46.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.6 _exptl_crystal_grow.pdbx_details '0.5M K/Na Tartrate, 0.2M LiSO4, 10% PEG3350, pH 7.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2006-10-12 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 channel' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97980 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97980 # _reflns.entry_id 2OT9 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.d_resolution_high 1.97 _reflns.d_resolution_low 50 _reflns.number_all 14451 _reflns.number_obs 14144 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.077 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 43.8 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 8.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.97 _reflns_shell.d_res_low 2.03 _reflns_shell.percent_possible_all 99.2 _reflns_shell.Rmerge_I_obs 0.284 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 6.4 _reflns_shell.pdbx_redundancy 6.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1421 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2OT9 _refine.ls_number_reflns_obs 13493 _refine.ls_number_reflns_all 13493 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 48.22 _refine.ls_d_res_high 1.97 _refine.ls_percent_reflns_obs 99.85 _refine.ls_R_factor_obs 0.18034 _refine.ls_R_factor_all 0.18034 _refine.ls_R_factor_R_work 0.1776 _refine.ls_R_factor_R_free 0.23911 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 713 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.960 _refine.correlation_coeff_Fo_to_Fc_free 0.932 _refine.B_iso_mean 28.673 _refine.aniso_B[1][1] 0.37 _refine.aniso_B[2][2] 0.16 _refine.aniso_B[3][3] -0.52 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.168 _refine.pdbx_overall_ESU_R_Free 0.164 _refine.overall_SU_ML 0.105 _refine.overall_SU_B 7.254 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1454 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 111 _refine_hist.number_atoms_total 1576 _refine_hist.d_res_high 1.97 _refine_hist.d_res_low 48.22 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.010 0.022 ? 1507 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.270 1.953 ? 2050 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.770 5.000 ? 180 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 33.744 23.467 ? 75 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.227 15.000 ? 260 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 13.631 15.000 ? 15 'X-RAY DIFFRACTION' ? r_chiral_restr 0.092 0.200 ? 227 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 1155 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.217 0.200 ? 627 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.310 0.200 ? 986 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.184 0.200 ? 114 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.258 0.200 ? 49 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.155 0.200 ? 18 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.670 1.500 ? 898 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.259 2.000 ? 1457 'X-RAY DIFFRACTION' ? r_scbond_it 1.953 3.000 ? 649 'X-RAY DIFFRACTION' ? r_scangle_it 3.192 4.500 ? 593 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.970 _refine_ls_shell.d_res_low 2.021 _refine_ls_shell.number_reflns_R_work 969 _refine_ls_shell.R_factor_R_work 0.205 _refine_ls_shell.percent_reflns_obs 99.04 _refine_ls_shell.R_factor_R_free 0.281 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 67 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 1036 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2OT9 _struct.title 'Crystal structure of YaeQ protein from Pseudomonas syringae' _struct.pdbx_descriptor 'Hypothetical protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2OT9 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;YaeQ protein, Pseudomonas syringae, PSI-2, Protein Structure Initiative, MCSG, Structural Genomics, Midwest Center for Structural Genomics, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details 'This protein exists as a monomer' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 36 ? TRP A 50 ? THR A 36 TRP A 50 1 ? 15 HELX_P HELX_P2 2 ARG A 59 ? ASP A 63 ? ARG A 59 ASP A 63 5 ? 5 HELX_P HELX_P3 3 ASP A 88 ? ARG A 97 ? ASP A 88 ARG A 97 1 ? 10 HELX_P HELX_P4 4 LEU A 110 ? ILE A 118 ? LEU A 110 ILE A 118 1 ? 9 HELX_P HELX_P5 5 PRO A 119 ? ILE A 121 ? PRO A 119 ILE A 121 5 ? 3 HELX_P HELX_P6 6 PRO A 133 ? LYS A 142 ? PRO A 133 LYS A 142 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ARG 39 C ? ? ? 1_555 A MSE 40 N ? ? A ARG 39 A MSE 40 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale ? ? A MSE 40 C ? ? ? 1_555 A THR 41 N ? ? A MSE 40 A THR 41 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A ASP 143 C ? ? ? 1_555 A MSE 144 N ? ? A ASP 143 A MSE 144 1_555 ? ? ? ? ? ? ? 1.322 ? covale4 covale ? ? A MSE 144 C ? ? ? 1_555 A PRO 145 N ? ? A MSE 144 A PRO 145 1_555 ? ? ? ? ? ? ? 1.344 ? covale5 covale ? ? A VAL 152 C ? ? ? 1_555 A MSE 153 N ? ? A VAL 152 A MSE 153 1_555 ? ? ? ? ? ? ? 1.332 ? covale6 covale ? ? A MSE 153 C ? ? ? 1_555 A ILE 154 N ? ? A MSE 153 A ILE 154 1_555 ? ? ? ? ? ? ? 1.329 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 2 A . ? ALA 2 A GLN 3 A ? GLN 3 A 1 -4.34 2 GLN 3 A . ? GLN 3 A PRO 4 A ? PRO 4 A 1 4.14 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel B 4 5 ? parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 21 ? ARG A 31 ? VAL A 21 ARG A 31 A 2 THR A 6 ? ASP A 16 ? THR A 6 ASP A 16 A 3 VAL A 147 ? SER A 155 ? VAL A 147 SER A 155 A 4 THR A 158 ? ASP A 163 ? THR A 158 ASP A 163 A 5 GLY A 166 ? VAL A 170 ? GLY A 166 VAL A 170 B 1 LEU A 55 ? PHE A 57 ? LEU A 55 PHE A 57 B 2 LEU A 69 ? LYS A 72 ? LEU A 69 LYS A 72 B 3 VAL A 78 ? VAL A 84 ? VAL A 78 VAL A 84 B 4 THR A 99 ? ALA A 106 ? THR A 99 ALA A 106 B 5 VAL A 127 ? ALA A 131 ? VAL A 127 ALA A 131 B 6 GLN A 173 ? THR A 176 ? GLN A 173 THR A 176 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 21 ? O VAL A 21 N ASP A 16 ? N ASP A 16 A 2 3 N GLU A 11 ? N GLU A 11 O ILE A 148 ? O ILE A 148 A 3 4 N ASP A 151 ? N ASP A 151 O THR A 162 ? O THR A 162 A 4 5 N VAL A 159 ? N VAL A 159 O VAL A 170 ? O VAL A 170 B 1 2 N ALA A 56 ? N ALA A 56 O TRP A 70 ? O TRP A 70 B 2 3 N GLU A 71 ? N GLU A 71 O LEU A 79 ? O LEU A 79 B 3 4 N TRP A 81 ? N TRP A 81 O SER A 103 ? O SER A 103 B 4 5 N ALA A 106 ? N ALA A 106 O ALA A 130 ? O ALA A 130 B 5 6 N ILE A 129 ? N ILE A 129 O LEU A 175 ? O LEU A 175 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA A 181' AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE SRT A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 MSE A 40 ? MSE A 40 . ? 1_555 ? 2 AC1 2 MSE A 144 ? MSE A 144 . ? 1_555 ? 3 AC2 11 ARG A 39 ? ARG A 39 . ? 1_555 ? 4 AC2 11 LEU A 61 ? LEU A 61 . ? 1_555 ? 5 AC2 11 VAL A 84 ? VAL A 84 . ? 1_555 ? 6 AC2 11 GLY A 85 ? GLY A 85 . ? 1_555 ? 7 AC2 11 GLN A 86 ? GLN A 86 . ? 1_555 ? 8 AC2 11 ARG A 91 ? ARG A 91 . ? 1_555 ? 9 AC2 11 TRP A 94 ? TRP A 94 . ? 4_465 ? 10 AC2 11 ARG A 97 ? ARG A 97 . ? 4_465 ? 11 AC2 11 HOH D . ? HOH A 216 . ? 1_555 ? 12 AC2 11 HOH D . ? HOH A 265 . ? 1_555 ? 13 AC2 11 HOH D . ? HOH A 270 . ? 1_555 ? # _database_PDB_matrix.entry_id 2OT9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2OT9 _atom_sites.fract_transf_matrix[1][1] 0.024807 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016285 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012849 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NA O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 MSE 40 40 40 MSE MSE A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 TRP 70 70 70 TRP TRP A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 TRP 81 81 81 TRP TRP A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 TRP 113 113 113 TRP TRP A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 MSE 144 144 144 MSE MSE A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 TRP 150 150 150 TRP TRP A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 MSE 153 153 153 MSE MSE A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 HIS 168 168 168 HIS HIS A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 GLN 171 171 171 GLN GLN A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 TRP 174 174 174 TRP TRP A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 GLY 180 180 180 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NA 1 181 1 NA NA A . C 3 SRT 1 201 1 SRT SRT A . D 4 HOH 1 202 2 HOH HOH A . D 4 HOH 2 203 3 HOH HOH A . D 4 HOH 3 204 4 HOH HOH A . D 4 HOH 4 205 5 HOH HOH A . D 4 HOH 5 206 6 HOH HOH A . D 4 HOH 6 207 7 HOH HOH A . D 4 HOH 7 208 8 HOH HOH A . D 4 HOH 8 209 9 HOH HOH A . D 4 HOH 9 210 10 HOH HOH A . D 4 HOH 10 211 11 HOH HOH A . D 4 HOH 11 212 12 HOH HOH A . D 4 HOH 12 213 13 HOH HOH A . D 4 HOH 13 214 14 HOH HOH A . D 4 HOH 14 215 15 HOH HOH A . D 4 HOH 15 216 16 HOH HOH A . D 4 HOH 16 217 17 HOH HOH A . D 4 HOH 17 218 18 HOH HOH A . D 4 HOH 18 219 19 HOH HOH A . D 4 HOH 19 220 20 HOH HOH A . D 4 HOH 20 221 21 HOH HOH A . D 4 HOH 21 222 22 HOH HOH A . D 4 HOH 22 223 23 HOH HOH A . D 4 HOH 23 224 24 HOH HOH A . D 4 HOH 24 225 25 HOH HOH A . D 4 HOH 25 226 26 HOH HOH A . D 4 HOH 26 227 27 HOH HOH A . D 4 HOH 27 228 28 HOH HOH A . D 4 HOH 28 229 29 HOH HOH A . D 4 HOH 29 230 30 HOH HOH A . D 4 HOH 30 231 31 HOH HOH A . D 4 HOH 31 232 32 HOH HOH A . D 4 HOH 32 233 33 HOH HOH A . D 4 HOH 33 234 34 HOH HOH A . D 4 HOH 34 235 35 HOH HOH A . D 4 HOH 35 236 36 HOH HOH A . D 4 HOH 36 237 37 HOH HOH A . D 4 HOH 37 238 38 HOH HOH A . D 4 HOH 38 239 39 HOH HOH A . D 4 HOH 39 240 41 HOH HOH A . D 4 HOH 40 241 42 HOH HOH A . D 4 HOH 41 242 43 HOH HOH A . D 4 HOH 42 243 44 HOH HOH A . D 4 HOH 43 244 45 HOH HOH A . D 4 HOH 44 245 46 HOH HOH A . D 4 HOH 45 246 48 HOH HOH A . D 4 HOH 46 247 49 HOH HOH A . D 4 HOH 47 248 50 HOH HOH A . D 4 HOH 48 249 51 HOH HOH A . D 4 HOH 49 250 52 HOH HOH A . D 4 HOH 50 251 53 HOH HOH A . D 4 HOH 51 252 54 HOH HOH A . D 4 HOH 52 253 55 HOH HOH A . D 4 HOH 53 254 56 HOH HOH A . D 4 HOH 54 255 57 HOH HOH A . D 4 HOH 55 256 58 HOH HOH A . D 4 HOH 56 257 60 HOH HOH A . D 4 HOH 57 258 61 HOH HOH A . D 4 HOH 58 259 62 HOH HOH A . D 4 HOH 59 260 63 HOH HOH A . D 4 HOH 60 261 66 HOH HOH A . D 4 HOH 61 262 67 HOH HOH A . D 4 HOH 62 263 68 HOH HOH A . D 4 HOH 63 264 70 HOH HOH A . D 4 HOH 64 265 71 HOH HOH A . D 4 HOH 65 266 72 HOH HOH A . D 4 HOH 66 267 75 HOH HOH A . D 4 HOH 67 268 78 HOH HOH A . D 4 HOH 68 269 80 HOH HOH A . D 4 HOH 69 270 81 HOH HOH A . D 4 HOH 70 271 82 HOH HOH A . D 4 HOH 71 272 83 HOH HOH A . D 4 HOH 72 273 85 HOH HOH A . D 4 HOH 73 274 87 HOH HOH A . D 4 HOH 74 275 89 HOH HOH A . D 4 HOH 75 276 90 HOH HOH A . D 4 HOH 76 277 91 HOH HOH A . D 4 HOH 77 278 92 HOH HOH A . D 4 HOH 78 279 93 HOH HOH A . D 4 HOH 79 280 100 HOH HOH A . D 4 HOH 80 281 104 HOH HOH A . D 4 HOH 81 282 107 HOH HOH A . D 4 HOH 82 283 111 HOH HOH A . D 4 HOH 83 284 112 HOH HOH A . D 4 HOH 84 285 113 HOH HOH A . D 4 HOH 85 286 116 HOH HOH A . D 4 HOH 86 287 117 HOH HOH A . D 4 HOH 87 288 122 HOH HOH A . D 4 HOH 88 289 129 HOH HOH A . D 4 HOH 89 290 134 HOH HOH A . D 4 HOH 90 291 135 HOH HOH A . D 4 HOH 91 292 136 HOH HOH A . D 4 HOH 92 293 139 HOH HOH A . D 4 HOH 93 294 141 HOH HOH A . D 4 HOH 94 295 145 HOH HOH A . D 4 HOH 95 296 147 HOH HOH A . D 4 HOH 96 297 148 HOH HOH A . D 4 HOH 97 298 149 HOH HOH A . D 4 HOH 98 299 150 HOH HOH A . D 4 HOH 99 300 151 HOH HOH A . D 4 HOH 100 301 153 HOH HOH A . D 4 HOH 101 302 158 HOH HOH A . D 4 HOH 102 303 162 HOH HOH A . D 4 HOH 103 304 163 HOH HOH A . D 4 HOH 104 305 164 HOH HOH A . D 4 HOH 105 306 165 HOH HOH A . D 4 HOH 106 307 7 HOH HOH A . D 4 HOH 107 308 12 HOH HOH A . D 4 HOH 108 309 16 HOH HOH A . D 4 HOH 109 310 22 HOH HOH A . D 4 HOH 110 311 24 HOH HOH A . D 4 HOH 111 312 27 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 40 A MSE 40 ? MET SELENOMETHIONINE 2 A MSE 144 A MSE 144 ? MET SELENOMETHIONINE 3 A MSE 153 A MSE 153 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-03-13 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Source and taxonomy' 4 3 'Structure model' 'Version format compliance' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 20.6218 _pdbx_refine_tls.origin_y 58.3520 _pdbx_refine_tls.origin_z 7.5879 _pdbx_refine_tls.T[1][1] -0.0722 _pdbx_refine_tls.T[2][2] -0.0633 _pdbx_refine_tls.T[3][3] -0.0975 _pdbx_refine_tls.T[1][2] -0.0083 _pdbx_refine_tls.T[1][3] 0.0047 _pdbx_refine_tls.T[2][3] -0.0195 _pdbx_refine_tls.L[1][1] 1.0780 _pdbx_refine_tls.L[2][2] 3.1827 _pdbx_refine_tls.L[3][3] 1.3773 _pdbx_refine_tls.L[1][2] -0.5303 _pdbx_refine_tls.L[1][3] 0.0256 _pdbx_refine_tls.L[2][3] 0.4920 _pdbx_refine_tls.S[1][1] -0.0988 _pdbx_refine_tls.S[1][2] -0.0167 _pdbx_refine_tls.S[1][3] 0.0186 _pdbx_refine_tls.S[2][1] -0.1033 _pdbx_refine_tls.S[2][2] 0.1099 _pdbx_refine_tls.S[2][3] -0.0846 _pdbx_refine_tls.S[3][1] -0.0498 _pdbx_refine_tls.S[3][2] 0.0373 _pdbx_refine_tls.S[3][3] -0.0111 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 3 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 3 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 180 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 180 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 HKL-3000 'data collection' . ? 2 HKL-3000 'data reduction' . ? 3 HKL-3000 'data scaling' . ? 4 HKL-3000 phasing . ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLY _pdbx_validate_close_contact.auth_seq_id_1 60 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 300 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 163 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -125.24 _pdbx_validate_torsion.psi -161.03 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 C2 ? A SRT 201 ? 'WRONG HAND' . 2 1 C3 ? A SRT 201 ? 'WRONG HAND' . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SODIUM ION' NA 3 'S,R MESO-TARTARIC ACID' SRT 4 water HOH #