data_2OVC # _entry.id 2OVC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2OVC pdb_00002ovc 10.2210/pdb2ovc/pdb RCSB RCSB041631 ? ? WWPDB D_1000041631 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-03-13 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-18 5 'Structure model' 1 4 2019-07-24 6 'Structure model' 1 5 2024-02-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Refinement description' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' software 3 6 'Structure model' chem_comp_atom 4 6 'Structure model' chem_comp_bond 5 6 'Structure model' database_2 6 6 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_software.classification' 2 5 'Structure model' '_software.contact_author' 3 5 'Structure model' '_software.contact_author_email' 4 5 'Structure model' '_software.language' 5 5 'Structure model' '_software.location' 6 5 'Structure model' '_software.name' 7 5 'Structure model' '_software.type' 8 6 'Structure model' '_database_2.pdbx_DOI' 9 6 'Structure model' '_database_2.pdbx_database_accession' 10 6 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.entry_id 2OVC _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-02-13 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Howard, R.J.' 1 'Clark, K.A.' 2 'Holton, J.M.' 3 'Minor, D.L.' 4 # _citation.id primary _citation.title 'Structural Insight into KCNQ (Kv7) Channel Assembly and Channelopathy.' _citation.journal_abbrev Neuron _citation.journal_volume 53 _citation.page_first 663 _citation.page_last 675 _citation.year 2007 _citation.journal_id_ASTM NERNET _citation.country US _citation.journal_id_ISSN 0896-6273 _citation.journal_id_CSD 2038 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17329207 _citation.pdbx_database_id_DOI 10.1016/j.neuron.2007.02.010 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Howard, R.J.' 1 ? primary 'Clark, K.A.' 2 ? primary 'Holton, J.M.' 3 ? primary 'Minor, D.L.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Potassium voltage-gated channel subfamily KQT member 4' 3738.399 1 ? ? 'coiled-coil assembly domain, residues 611-640' ? 2 water nat water 18.015 18 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Voltage-gated potassium channel subunit Kv7.4, Potassium channel subunit alpha KvLQT4, KQT-like 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GAVDEISMMGRVVKVEKQVQSIEHKLDLLLGFY _entity_poly.pdbx_seq_one_letter_code_can GAVDEISMMGRVVKVEKQVQSIEHKLDLLLGFY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 VAL n 1 4 ASP n 1 5 GLU n 1 6 ILE n 1 7 SER n 1 8 MET n 1 9 MET n 1 10 GLY n 1 11 ARG n 1 12 VAL n 1 13 VAL n 1 14 LYS n 1 15 VAL n 1 16 GLU n 1 17 LYS n 1 18 GLN n 1 19 VAL n 1 20 GLN n 1 21 SER n 1 22 ILE n 1 23 GLU n 1 24 HIS n 1 25 LYS n 1 26 LEU n 1 27 ASP n 1 28 LEU n 1 29 LEU n 1 30 LEU n 1 31 GLY n 1 32 PHE n 1 33 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene KCNQ4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pSV272 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 VAL 3 3 ? ? ? A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 TYR 33 33 33 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 34 1 HOH HOH A . B 2 HOH 2 35 2 HOH HOH A . B 2 HOH 3 36 3 HOH HOH A . B 2 HOH 4 37 4 HOH HOH A . B 2 HOH 5 38 5 HOH HOH A . B 2 HOH 6 39 6 HOH HOH A . B 2 HOH 7 40 7 HOH HOH A . B 2 HOH 8 41 8 HOH HOH A . B 2 HOH 9 42 9 HOH HOH A . B 2 HOH 10 43 10 HOH HOH A . B 2 HOH 11 44 11 HOH HOH A . B 2 HOH 12 45 12 HOH HOH A . B 2 HOH 13 46 13 HOH HOH A . B 2 HOH 14 47 14 HOH HOH A . B 2 HOH 15 48 15 HOH HOH A . B 2 HOH 16 49 16 HOH HOH A . B 2 HOH 17 50 17 HOH HOH A . B 2 HOH 18 51 18 HOH HOH A . # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns.csb.yale.edu/v1.1/ Fortran_77 ? 3 DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 4 PDB_EXTRACT 2.000 'April. 3, 2006' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 5 ADSC QUANTUM ? ? ? ? 'data collection' ? ? ? 6 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 7 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? 8 CNS . ? ? ? ? phasing ? ? ? 9 # _cell.length_a 33.185 _cell.length_b 33.185 _cell.length_c 55.283 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 2OVC _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'I 4' _symmetry.entry_id 2OVC _symmetry.Int_Tables_number 79 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 2OVC _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_percent_sol 43.25 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.temp 289 _exptl_crystal_grow.pdbx_details '45% MPD, 0.2M ammonium acetate, 0.1M Bis-Tris, pH 5.5, vapor diffusion, hanging drop, temperature 289K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 1 2 ? ? 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2005-05-20 _diffrn_detector.details 'Double Crystal' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Double Crystal' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.116 _diffrn_radiation_wavelength.wt 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline 1 SYNCHROTRON 'ALS BEAMLINE 8.3.1' 1.116 ? ALS 8.3.1 2 ? ? ? ? ? ? # _reflns.entry_id 2OVC _reflns.d_resolution_high 2.070 _reflns.d_resolution_low 28.46 _reflns.number_obs 1841 _reflns.pdbx_Rmerge_I_obs 0.053 _reflns.pdbx_netI_over_sigmaI 15.300 _reflns.pdbx_chi_squared 0.913 _reflns.pdbx_redundancy 7.300 _reflns.percent_possible_obs 99.600 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.07 2.14 ? ? ? 0.096 ? ? 0.504 6.10 ? 194 100.00 1 1 2.14 2.23 ? ? ? 0.091 ? ? 0.516 7.00 ? 184 100.00 2 1 2.23 2.33 ? ? ? 0.092 ? ? 0.597 7.40 ? 169 100.00 3 1 2.33 2.45 ? ? ? 0.075 ? ? 0.668 7.60 ? 195 100.00 4 1 2.45 2.61 ? ? ? 0.065 ? ? 0.817 7.40 ? 176 100.00 5 1 2.61 2.81 ? ? ? 0.064 ? ? 0.961 7.60 ? 188 100.00 6 1 2.81 3.09 ? ? ? 0.055 ? ? 1.142 7.50 ? 177 100.00 7 1 3.09 3.54 ? ? ? 0.056 ? ? 1.515 7.50 ? 187 100.00 8 1 3.54 4.46 ? ? ? 0.04 ? ? 1.088 7.50 ? 185 100.00 9 1 4.46 50.00 ? ? ? 0.043 ? ? 1.225 7.10 ? 186 95.90 10 1 # _refine.entry_id 2OVC _refine.ls_d_res_high 2.070 _refine.ls_d_res_low 28.460 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 99.250 _refine.ls_number_reflns_obs 1841 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_obs 0.197 _refine.ls_R_factor_R_work 0.196 _refine.ls_R_factor_R_free 0.224 _refine.ls_percent_reflns_R_free 4.400 _refine.ls_number_reflns_R_free 81 _refine.B_iso_mean 22.128 _refine.aniso_B[1][1] -0.240 _refine.aniso_B[2][2] -0.240 _refine.aniso_B[3][3] 0.480 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.943 _refine.correlation_coeff_Fo_to_Fc_free 0.937 _refine.pdbx_overall_ESU_R 0.257 _refine.pdbx_overall_ESU_R_Free 0.184 _refine.overall_SU_ML 0.175 _refine.overall_SU_B 7.183 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 245 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 263 _refine_hist.d_res_high 2.070 _refine_hist.d_res_low 28.460 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 251 0.014 0.022 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 334 1.586 2.005 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 29 5.170 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 11 48.328 25.455 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 57 18.303 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 1 2.443 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 39 0.100 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 174 0.004 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 93 0.224 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 175 0.304 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 4 0.256 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 28 0.215 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 9 0.195 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 155 0.854 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 242 1.513 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 107 2.565 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 92 4.569 4.500 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 2.074 _refine_ls_shell.d_res_low 2.128 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 95.950 _refine_ls_shell.number_reflns_R_work 138 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.261 _refine_ls_shell.R_factor_R_free 0.185 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 4 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 142 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2OVC _struct.title 'Crystal structure of a coiled-coil tetramerization domain from Kv7.4 channels' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2OVC _struct_keywords.text 'Voltage-gated channel, Potassium channel, Ion channel assembly, Coiled-coil, Tetramer, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KCNQ4_HUMAN _struct_ref.pdbx_db_accession P56696 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DEISMMGRVVKVEKQVQSIEHKLDLLLGFY _struct_ref.pdbx_align_begin 611 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2OVC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 33 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56696 _struct_ref_seq.db_align_beg 610 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 640 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 33 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2OVC GLY A 1 ? UNP P56696 ? ? 'cloning artifact' 1 1 1 2OVC ALA A 2 ? UNP P56696 ? ? 'cloning artifact' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6090 ? 1 MORE -53 ? 1 'SSA (A^2)' 6890 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 33.1850000000 0.0000000000 -1.0000000000 0.0000000000 33.1850000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -y+1,x,z 0.0000000000 -1.0000000000 0.0000000000 33.1850000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_565 y,-x+1,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 33.1850000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _struct_biol.id 1 _struct_biol.details ;The biological assembly is a tetramer generated from the monomer in the asymmetric unit by the operations: y, 1-x, z; 1-x, 1-y, z; and 1-y, x, z ; _struct_biol.pdbx_parent_biol_id ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 4 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 31 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 4 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 31 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_phasing_MR.entry_id 2OVC _pdbx_phasing_MR.method_rotation 'fast direct' _pdbx_phasing_MR.method_translation &STRIP%trans_method _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation ? _pdbx_phasing_MR.d_res_low_rotation ? _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A VAL 3 ? A VAL 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 HOH O O N N 127 HOH H1 H N N 128 HOH H2 H N N 129 ILE N N N N 130 ILE CA C N S 131 ILE C C N N 132 ILE O O N N 133 ILE CB C N S 134 ILE CG1 C N N 135 ILE CG2 C N N 136 ILE CD1 C N N 137 ILE OXT O N N 138 ILE H H N N 139 ILE H2 H N N 140 ILE HA H N N 141 ILE HB H N N 142 ILE HG12 H N N 143 ILE HG13 H N N 144 ILE HG21 H N N 145 ILE HG22 H N N 146 ILE HG23 H N N 147 ILE HD11 H N N 148 ILE HD12 H N N 149 ILE HD13 H N N 150 ILE HXT H N N 151 LEU N N N N 152 LEU CA C N S 153 LEU C C N N 154 LEU O O N N 155 LEU CB C N N 156 LEU CG C N N 157 LEU CD1 C N N 158 LEU CD2 C N N 159 LEU OXT O N N 160 LEU H H N N 161 LEU H2 H N N 162 LEU HA H N N 163 LEU HB2 H N N 164 LEU HB3 H N N 165 LEU HG H N N 166 LEU HD11 H N N 167 LEU HD12 H N N 168 LEU HD13 H N N 169 LEU HD21 H N N 170 LEU HD22 H N N 171 LEU HD23 H N N 172 LEU HXT H N N 173 LYS N N N N 174 LYS CA C N S 175 LYS C C N N 176 LYS O O N N 177 LYS CB C N N 178 LYS CG C N N 179 LYS CD C N N 180 LYS CE C N N 181 LYS NZ N N N 182 LYS OXT O N N 183 LYS H H N N 184 LYS H2 H N N 185 LYS HA H N N 186 LYS HB2 H N N 187 LYS HB3 H N N 188 LYS HG2 H N N 189 LYS HG3 H N N 190 LYS HD2 H N N 191 LYS HD3 H N N 192 LYS HE2 H N N 193 LYS HE3 H N N 194 LYS HZ1 H N N 195 LYS HZ2 H N N 196 LYS HZ3 H N N 197 LYS HXT H N N 198 MET N N N N 199 MET CA C N S 200 MET C C N N 201 MET O O N N 202 MET CB C N N 203 MET CG C N N 204 MET SD S N N 205 MET CE C N N 206 MET OXT O N N 207 MET H H N N 208 MET H2 H N N 209 MET HA H N N 210 MET HB2 H N N 211 MET HB3 H N N 212 MET HG2 H N N 213 MET HG3 H N N 214 MET HE1 H N N 215 MET HE2 H N N 216 MET HE3 H N N 217 MET HXT H N N 218 PHE N N N N 219 PHE CA C N S 220 PHE C C N N 221 PHE O O N N 222 PHE CB C N N 223 PHE CG C Y N 224 PHE CD1 C Y N 225 PHE CD2 C Y N 226 PHE CE1 C Y N 227 PHE CE2 C Y N 228 PHE CZ C Y N 229 PHE OXT O N N 230 PHE H H N N 231 PHE H2 H N N 232 PHE HA H N N 233 PHE HB2 H N N 234 PHE HB3 H N N 235 PHE HD1 H N N 236 PHE HD2 H N N 237 PHE HE1 H N N 238 PHE HE2 H N N 239 PHE HZ H N N 240 PHE HXT H N N 241 SER N N N N 242 SER CA C N S 243 SER C C N N 244 SER O O N N 245 SER CB C N N 246 SER OG O N N 247 SER OXT O N N 248 SER H H N N 249 SER H2 H N N 250 SER HA H N N 251 SER HB2 H N N 252 SER HB3 H N N 253 SER HG H N N 254 SER HXT H N N 255 TYR N N N N 256 TYR CA C N S 257 TYR C C N N 258 TYR O O N N 259 TYR CB C N N 260 TYR CG C Y N 261 TYR CD1 C Y N 262 TYR CD2 C Y N 263 TYR CE1 C Y N 264 TYR CE2 C Y N 265 TYR CZ C Y N 266 TYR OH O N N 267 TYR OXT O N N 268 TYR H H N N 269 TYR H2 H N N 270 TYR HA H N N 271 TYR HB2 H N N 272 TYR HB3 H N N 273 TYR HD1 H N N 274 TYR HD2 H N N 275 TYR HE1 H N N 276 TYR HE2 H N N 277 TYR HH H N N 278 TYR HXT H N N 279 VAL N N N N 280 VAL CA C N S 281 VAL C C N N 282 VAL O O N N 283 VAL CB C N N 284 VAL CG1 C N N 285 VAL CG2 C N N 286 VAL OXT O N N 287 VAL H H N N 288 VAL H2 H N N 289 VAL HA H N N 290 VAL HB H N N 291 VAL HG11 H N N 292 VAL HG12 H N N 293 VAL HG13 H N N 294 VAL HG21 H N N 295 VAL HG22 H N N 296 VAL HG23 H N N 297 VAL HXT H N N 298 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 HOH O H1 sing N N 121 HOH O H2 sing N N 122 ILE N CA sing N N 123 ILE N H sing N N 124 ILE N H2 sing N N 125 ILE CA C sing N N 126 ILE CA CB sing N N 127 ILE CA HA sing N N 128 ILE C O doub N N 129 ILE C OXT sing N N 130 ILE CB CG1 sing N N 131 ILE CB CG2 sing N N 132 ILE CB HB sing N N 133 ILE CG1 CD1 sing N N 134 ILE CG1 HG12 sing N N 135 ILE CG1 HG13 sing N N 136 ILE CG2 HG21 sing N N 137 ILE CG2 HG22 sing N N 138 ILE CG2 HG23 sing N N 139 ILE CD1 HD11 sing N N 140 ILE CD1 HD12 sing N N 141 ILE CD1 HD13 sing N N 142 ILE OXT HXT sing N N 143 LEU N CA sing N N 144 LEU N H sing N N 145 LEU N H2 sing N N 146 LEU CA C sing N N 147 LEU CA CB sing N N 148 LEU CA HA sing N N 149 LEU C O doub N N 150 LEU C OXT sing N N 151 LEU CB CG sing N N 152 LEU CB HB2 sing N N 153 LEU CB HB3 sing N N 154 LEU CG CD1 sing N N 155 LEU CG CD2 sing N N 156 LEU CG HG sing N N 157 LEU CD1 HD11 sing N N 158 LEU CD1 HD12 sing N N 159 LEU CD1 HD13 sing N N 160 LEU CD2 HD21 sing N N 161 LEU CD2 HD22 sing N N 162 LEU CD2 HD23 sing N N 163 LEU OXT HXT sing N N 164 LYS N CA sing N N 165 LYS N H sing N N 166 LYS N H2 sing N N 167 LYS CA C sing N N 168 LYS CA CB sing N N 169 LYS CA HA sing N N 170 LYS C O doub N N 171 LYS C OXT sing N N 172 LYS CB CG sing N N 173 LYS CB HB2 sing N N 174 LYS CB HB3 sing N N 175 LYS CG CD sing N N 176 LYS CG HG2 sing N N 177 LYS CG HG3 sing N N 178 LYS CD CE sing N N 179 LYS CD HD2 sing N N 180 LYS CD HD3 sing N N 181 LYS CE NZ sing N N 182 LYS CE HE2 sing N N 183 LYS CE HE3 sing N N 184 LYS NZ HZ1 sing N N 185 LYS NZ HZ2 sing N N 186 LYS NZ HZ3 sing N N 187 LYS OXT HXT sing N N 188 MET N CA sing N N 189 MET N H sing N N 190 MET N H2 sing N N 191 MET CA C sing N N 192 MET CA CB sing N N 193 MET CA HA sing N N 194 MET C O doub N N 195 MET C OXT sing N N 196 MET CB CG sing N N 197 MET CB HB2 sing N N 198 MET CB HB3 sing N N 199 MET CG SD sing N N 200 MET CG HG2 sing N N 201 MET CG HG3 sing N N 202 MET SD CE sing N N 203 MET CE HE1 sing N N 204 MET CE HE2 sing N N 205 MET CE HE3 sing N N 206 MET OXT HXT sing N N 207 PHE N CA sing N N 208 PHE N H sing N N 209 PHE N H2 sing N N 210 PHE CA C sing N N 211 PHE CA CB sing N N 212 PHE CA HA sing N N 213 PHE C O doub N N 214 PHE C OXT sing N N 215 PHE CB CG sing N N 216 PHE CB HB2 sing N N 217 PHE CB HB3 sing N N 218 PHE CG CD1 doub Y N 219 PHE CG CD2 sing Y N 220 PHE CD1 CE1 sing Y N 221 PHE CD1 HD1 sing N N 222 PHE CD2 CE2 doub Y N 223 PHE CD2 HD2 sing N N 224 PHE CE1 CZ doub Y N 225 PHE CE1 HE1 sing N N 226 PHE CE2 CZ sing Y N 227 PHE CE2 HE2 sing N N 228 PHE CZ HZ sing N N 229 PHE OXT HXT sing N N 230 SER N CA sing N N 231 SER N H sing N N 232 SER N H2 sing N N 233 SER CA C sing N N 234 SER CA CB sing N N 235 SER CA HA sing N N 236 SER C O doub N N 237 SER C OXT sing N N 238 SER CB OG sing N N 239 SER CB HB2 sing N N 240 SER CB HB3 sing N N 241 SER OG HG sing N N 242 SER OXT HXT sing N N 243 TYR N CA sing N N 244 TYR N H sing N N 245 TYR N H2 sing N N 246 TYR CA C sing N N 247 TYR CA CB sing N N 248 TYR CA HA sing N N 249 TYR C O doub N N 250 TYR C OXT sing N N 251 TYR CB CG sing N N 252 TYR CB HB2 sing N N 253 TYR CB HB3 sing N N 254 TYR CG CD1 doub Y N 255 TYR CG CD2 sing Y N 256 TYR CD1 CE1 sing Y N 257 TYR CD1 HD1 sing N N 258 TYR CD2 CE2 doub Y N 259 TYR CD2 HD2 sing N N 260 TYR CE1 CZ doub Y N 261 TYR CE1 HE1 sing N N 262 TYR CE2 CZ sing Y N 263 TYR CE2 HE2 sing N N 264 TYR CZ OH sing N N 265 TYR OH HH sing N N 266 TYR OXT HXT sing N N 267 VAL N CA sing N N 268 VAL N H sing N N 269 VAL N H2 sing N N 270 VAL CA C sing N N 271 VAL CA CB sing N N 272 VAL CA HA sing N N 273 VAL C O doub N N 274 VAL C OXT sing N N 275 VAL CB CG1 sing N N 276 VAL CB CG2 sing N N 277 VAL CB HB sing N N 278 VAL CG1 HG11 sing N N 279 VAL CG1 HG12 sing N N 280 VAL CG1 HG13 sing N N 281 VAL CG2 HG21 sing N N 282 VAL CG2 HG22 sing N N 283 VAL CG2 HG23 sing N N 284 VAL OXT HXT sing N N 285 # _atom_sites.entry_id 2OVC _atom_sites.fract_transf_matrix[1][1] 0.030134 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.030134 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018089 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ #