data_2OVE # _entry.id 2OVE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2OVE pdb_00002ove 10.2210/pdb2ove/pdb RCSB RCSB041633 ? ? WWPDB D_1000041633 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1IW2 . unspecified PDB 1LF7 . unspecified PDB 2OVA . unspecified PDB 2OVD . unspecified # _pdbx_database_status.entry_id 2OVE _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-02-13 _pdbx_database_status.SG_entry N _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chiswell, B.' 1 'Lovelace, L.L.' 2 'Brannen, C.' 3 'Ortlund, E.A.' 4 'Lebioda, L.' 5 'Sodetz, J.M.' 6 # _citation.id primary _citation.title 'Structural features of the ligand binding site on human complement protein C8gamma: A member of the lipocalin family' _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_volume 1774 _citation.page_first 637 _citation.page_last 644 _citation.year 2007 _citation.journal_id_ASTM BBACAQ _citation.country NE _citation.journal_id_ISSN 0006-3002 _citation.journal_id_CSD 0113 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17452033 _citation.pdbx_database_id_DOI 10.1016/j.bbapap.2007.03.004 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chiswell, B.' 1 ? primary 'Lovelace, L.L.' 2 ? primary 'Brannen, C.' 3 ? primary 'Ortlund, E.A.' 4 ? primary 'Lebioda, L.' 5 ? primary 'Sodetz, J.M.' 6 ? # _cell.length_a 42.227 _cell.length_b 59.775 _cell.length_c 71.901 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 2OVE _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.entry_id 2OVE _symmetry.Int_Tables_number 19 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Complement component 8, gamma polypeptide' 20320.004 1 ? Y83W ? ? 2 water nat water 18.015 119 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Complement Protein C8gamma' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAARFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVR QLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF YFPKYGFCEAADQFHVLDEVRR ; _entity_poly.pdbx_seq_one_letter_code_can ;QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAARFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVR QLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF YFPKYGFCEAADQFHVLDEVRR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 LYS n 1 3 PRO n 1 4 GLN n 1 5 ARG n 1 6 PRO n 1 7 ARG n 1 8 ARG n 1 9 PRO n 1 10 ALA n 1 11 SER n 1 12 PRO n 1 13 ILE n 1 14 SER n 1 15 THR n 1 16 ILE n 1 17 GLN n 1 18 PRO n 1 19 LYS n 1 20 ALA n 1 21 ASN n 1 22 PHE n 1 23 ASP n 1 24 ALA n 1 25 GLN n 1 26 GLN n 1 27 PHE n 1 28 ALA n 1 29 GLY n 1 30 THR n 1 31 TRP n 1 32 LEU n 1 33 LEU n 1 34 VAL n 1 35 ALA n 1 36 VAL n 1 37 GLY n 1 38 SER n 1 39 ALA n 1 40 ALA n 1 41 ARG n 1 42 PHE n 1 43 LEU n 1 44 GLN n 1 45 GLU n 1 46 GLN n 1 47 GLY n 1 48 HIS n 1 49 ARG n 1 50 ALA n 1 51 GLU n 1 52 ALA n 1 53 THR n 1 54 THR n 1 55 LEU n 1 56 HIS n 1 57 VAL n 1 58 ALA n 1 59 PRO n 1 60 GLN n 1 61 GLY n 1 62 THR n 1 63 ALA n 1 64 MET n 1 65 ALA n 1 66 VAL n 1 67 SER n 1 68 THR n 1 69 PHE n 1 70 ARG n 1 71 LYS n 1 72 LEU n 1 73 ASP n 1 74 GLY n 1 75 ILE n 1 76 CYS n 1 77 TRP n 1 78 GLN n 1 79 VAL n 1 80 ARG n 1 81 GLN n 1 82 LEU n 1 83 TYR n 1 84 GLY n 1 85 ASP n 1 86 THR n 1 87 GLY n 1 88 VAL n 1 89 LEU n 1 90 GLY n 1 91 ARG n 1 92 PHE n 1 93 LEU n 1 94 LEU n 1 95 GLN n 1 96 ALA n 1 97 ARG n 1 98 GLY n 1 99 ALA n 1 100 ARG n 1 101 GLY n 1 102 ALA n 1 103 VAL n 1 104 HIS n 1 105 VAL n 1 106 VAL n 1 107 VAL n 1 108 ALA n 1 109 GLU n 1 110 THR n 1 111 ASP n 1 112 TYR n 1 113 GLN n 1 114 SER n 1 115 PHE n 1 116 ALA n 1 117 VAL n 1 118 LEU n 1 119 TYR n 1 120 LEU n 1 121 GLU n 1 122 ARG n 1 123 ALA n 1 124 GLY n 1 125 GLN n 1 126 LEU n 1 127 SER n 1 128 VAL n 1 129 LYS n 1 130 LEU n 1 131 TYR n 1 132 ALA n 1 133 ARG n 1 134 SER n 1 135 LEU n 1 136 PRO n 1 137 VAL n 1 138 SER n 1 139 ASP n 1 140 SER n 1 141 VAL n 1 142 LEU n 1 143 SER n 1 144 GLY n 1 145 PHE n 1 146 GLU n 1 147 GLN n 1 148 ARG n 1 149 VAL n 1 150 GLN n 1 151 GLU n 1 152 ALA n 1 153 HIS n 1 154 LEU n 1 155 THR n 1 156 GLU n 1 157 ASP n 1 158 GLN n 1 159 ILE n 1 160 PHE n 1 161 TYR n 1 162 PHE n 1 163 PRO n 1 164 LYS n 1 165 TYR n 1 166 GLY n 1 167 PHE n 1 168 CYS n 1 169 GLU n 1 170 ALA n 1 171 ALA n 1 172 ASP n 1 173 GLN n 1 174 PHE n 1 175 HIS n 1 176 VAL n 1 177 LEU n 1 178 ASP n 1 179 GLU n 1 180 VAL n 1 181 ARG n 1 182 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene C8G _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Origami B(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-17b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code Q14CU0_HUMAN _struct_ref.pdbx_db_accession Q14CU0 _struct_ref.pdbx_align_begin 21 _struct_ref.pdbx_seq_one_letter_code ;QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVR QLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF YFPKYGFCEAADQFHVLDEVRR ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2OVE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14CU0 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 202 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 182 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2OVE _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 40 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q14CU0 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 60 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 40 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2OVE _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_percent_sol 44.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.temp 290 _exptl_crystal_grow.pdbx_details '0.1 M sodium citrate and 25-27% PEG 4000, pH 4.0, VAPOR DIFFUSION, HANGING DROP, temperature 290K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2003-02-16 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'double crystal' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98925 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.98925 _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM # _reflns.entry_id 2OVE _reflns.d_resolution_high 2.000 _reflns.d_resolution_low 50.000 _reflns.number_obs 12610 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_netI_over_sigmaI 12.600 _reflns.pdbx_chi_squared 1.043 _reflns.pdbx_redundancy 4.300 _reflns.percent_possible_obs 97.800 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 2.0 _reflns.number_all 12901 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.07 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.114 _reflns_shell.meanI_over_sigI_obs 8.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.775 _reflns_shell.pdbx_redundancy 4.10 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1188 _reflns_shell.percent_possible_all 95.00 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2OVE _refine.ls_d_res_high 2.000 _refine.ls_d_res_low 500.000 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 96.100 _refine.ls_number_reflns_obs 12321 _refine.ls_R_factor_R_work 0.226 _refine.ls_R_factor_R_free 0.26 _refine.ls_percent_reflns_R_free 9.900 _refine.ls_number_reflns_R_free 1269 _refine.B_iso_mean 30.243 _refine.solvent_model_param_bsol 54.275 _refine.aniso_B[1][1] 2.468 _refine.aniso_B[2][2] 5.921 _refine.aniso_B[3][3] -8.389 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.overall_FOM_work_R_set 0.840 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1256 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 119 _refine_hist.number_atoms_total 1375 _refine_hist.d_res_high 2.000 _refine_hist.d_res_low 500.000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.006 ? ? 'X-RAY DIFFRACTION' ? c_angle_deg ? 1.148 ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? 1.924 1.500 ? 'X-RAY DIFFRACTION' ? c_scbond_it ? 2.359 2.000 ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? 3.245 2.000 ? 'X-RAY DIFFRACTION' ? c_scangle_it ? 3.692 2.500 ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 2.000 2.030 25 . 410 . 0.233 0.33 . 40 . . 450 . 'X-RAY DIFFRACTION' 2.030 2.060 25 . 389 . 0.241 0.273 . 68 . . 457 . 'X-RAY DIFFRACTION' 2.060 2.090 25 . 429 . 0.239 0.273 . 49 . . 478 . 'X-RAY DIFFRACTION' 2.090 2.120 25 . 409 . 0.222 0.259 . 55 . . 464 . 'X-RAY DIFFRACTION' 2.120 2.150 25 . 432 . 0.227 0.249 . 54 . . 486 . 'X-RAY DIFFRACTION' 2.150 2.190 25 . 435 . 0.228 0.288 . 45 . . 480 . 'X-RAY DIFFRACTION' 2.190 2.230 25 . 437 . 0.232 0.245 . 51 . . 488 . 'X-RAY DIFFRACTION' 2.230 2.270 25 . 432 . 0.212 0.223 . 44 . . 476 . 'X-RAY DIFFRACTION' 2.270 2.320 25 . 438 . 0.198 0.253 . 47 . . 485 . 'X-RAY DIFFRACTION' 2.320 2.370 25 . 437 . 0.237 0.299 . 48 . . 485 . 'X-RAY DIFFRACTION' 2.370 2.430 25 . 437 . 0.237 0.26 . 53 . . 490 . 'X-RAY DIFFRACTION' 2.430 2.490 25 . 457 . 0.252 0.328 . 44 . . 501 . 'X-RAY DIFFRACTION' 2.490 2.550 25 . 433 . 0.244 0.243 . 58 . . 491 . 'X-RAY DIFFRACTION' 2.550 2.630 25 . 477 . 0.245 0.382 . 34 . . 511 . 'X-RAY DIFFRACTION' 2.630 2.710 25 . 455 . 0.255 0.266 . 43 . . 498 . 'X-RAY DIFFRACTION' 2.710 2.810 25 . 449 . 0.219 0.226 . 57 . . 506 . 'X-RAY DIFFRACTION' 2.810 2.920 25 . 433 . 0.222 0.295 . 58 . . 491 . 'X-RAY DIFFRACTION' 2.920 3.060 25 . 438 . 0.229 0.255 . 51 . . 489 . 'X-RAY DIFFRACTION' 3.060 3.220 25 . 457 . 0.223 0.26 . 53 . . 510 . 'X-RAY DIFFRACTION' 3.220 3.420 25 . 456 . 0.228 0.26 . 47 . . 503 . 'X-RAY DIFFRACTION' 3.420 3.680 25 . 453 . 0.208 0.193 . 53 . . 506 . 'X-RAY DIFFRACTION' 3.680 4.050 25 . 462 . 0.224 0.253 . 50 . . 512 . 'X-RAY DIFFRACTION' 4.050 4.640 25 . 462 . 0.213 0.273 . 50 . . 512 . 'X-RAY DIFFRACTION' 4.640 5.850 25 . 464 . 0.202 0.248 . 58 . . 522 . 'X-RAY DIFFRACTION' 5.850 500.010 25 . 471 . 0.254 0.267 . 59 . . 530 . 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 CNS_TOPPAR:protein_rep.paramHicup CNS_TOPPAR:protein.topHIcup 'X-RAY DIFFRACTION' 2 CNS_TOPPAR:dna-rna_rep.param CNS_TOPPAR:dna-rna.top 'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water_rep.param CNS_TOPPAR:water.top 'X-RAY DIFFRACTION' 4 CNS_TOPPAR:ion.param CNS_TOPPAR:ion.top 'X-RAY DIFFRACTION' # _struct.entry_id 2OVE _struct.title 'Crystal Structure of Recombinant Human Complement Protein C8gamma' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2OVE _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN,LIGAND BINDING PROTEIN' _struct_keywords.text 'lipocalin; beta barrel, TRANSPORT PROTEIN, LIGAND BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 11 ? ILE A 16 ? SER A 11 ILE A 16 5 ? 6 HELX_P HELX_P2 2 ASP A 23 ? ALA A 28 ? ASP A 23 ALA A 28 1 ? 6 HELX_P HELX_P3 3 SER A 138 ? ALA A 152 ? SER A 138 ALA A 152 1 ? 15 HELX_P HELX_P4 4 THR A 155 ? ASP A 157 ? THR A 155 ASP A 157 5 ? 3 HELX_P HELX_P5 5 ASP A 172 ? PHE A 174 ? ASP A 172 PHE A 174 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 76 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 168 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 76 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 168 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.052 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 135 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 135 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 136 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 136 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.35 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel B 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 159 ? TYR A 161 ? ILE A 159 TYR A 161 A 2 GLY A 29 ? GLY A 37 ? GLY A 29 GLY A 37 A 3 THR A 53 ? GLN A 60 ? THR A 53 GLN A 60 A 4 ALA A 63 ? LEU A 72 ? ALA A 63 LEU A 72 A 5 ILE A 75 ? ASP A 85 ? ILE A 75 ASP A 85 A 6 VAL A 176 ? ASP A 178 ? VAL A 176 ASP A 178 B 1 ILE A 159 ? TYR A 161 ? ILE A 159 TYR A 161 B 2 GLY A 29 ? GLY A 37 ? GLY A 29 GLY A 37 B 3 GLN A 125 ? ALA A 132 ? GLN A 125 ALA A 132 B 4 PHE A 115 ? ARG A 122 ? PHE A 115 ARG A 122 B 5 VAL A 103 ? THR A 110 ? VAL A 103 THR A 110 B 6 ARG A 91 ? LEU A 94 ? ARG A 91 LEU A 94 B 7 ILE A 75 ? ASP A 85 ? ILE A 75 ASP A 85 B 8 VAL A 176 ? ASP A 178 ? VAL A 176 ASP A 178 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 160 ? O PHE A 160 N VAL A 36 ? N VAL A 36 A 2 3 N TRP A 31 ? N TRP A 31 O LEU A 55 ? O LEU A 55 A 3 4 N GLN A 60 ? N GLN A 60 O ALA A 63 ? O ALA A 63 A 4 5 N MET A 64 ? N MET A 64 O TYR A 83 ? O TYR A 83 A 5 6 N GLN A 78 ? N GLN A 78 O LEU A 177 ? O LEU A 177 B 1 2 O PHE A 160 ? O PHE A 160 N VAL A 36 ? N VAL A 36 B 2 3 N GLY A 37 ? N GLY A 37 O VAL A 128 ? O VAL A 128 B 3 4 O LYS A 129 ? O LYS A 129 N LEU A 118 ? N LEU A 118 B 4 5 O VAL A 117 ? O VAL A 117 N GLU A 109 ? N GLU A 109 B 5 6 O VAL A 105 ? O VAL A 105 N PHE A 92 ? N PHE A 92 B 6 7 O LEU A 93 ? O LEU A 93 N GLY A 84 ? N GLY A 84 B 7 8 N GLN A 78 ? N GLN A 78 O LEU A 177 ? O LEU A 177 # _atom_sites.entry_id 2OVE _atom_sites.fract_transf_matrix[1][1] 0.023682 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016729 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013908 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 ARG 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 ARG 7 7 ? ? ? A . n A 1 8 ARG 8 8 ? ? ? A . n A 1 9 PRO 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 PHE 42 42 ? ? ? A . n A 1 43 LEU 43 43 ? ? ? A . n A 1 44 GLN 44 44 ? ? ? A . n A 1 45 GLU 45 45 ? ? ? A . n A 1 46 GLN 46 46 ? ? ? A . n A 1 47 GLY 47 47 ? ? ? A . n A 1 48 HIS 48 48 ? ? ? A . n A 1 49 ARG 49 49 ? ? ? A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 CYS 168 168 168 CYS CYS A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 HIS 175 175 175 HIS HIS A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ASP 178 178 178 ASP ASP A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 ARG 181 181 ? ? ? A . n A 1 182 ARG 182 182 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 1001 1001 HOH HOH A . B 2 HOH 2 1002 1002 HOH HOH A . B 2 HOH 3 1003 1003 HOH HOH A . B 2 HOH 4 1004 1004 HOH HOH A . B 2 HOH 5 1005 1005 HOH HOH A . B 2 HOH 6 1006 1006 HOH HOH A . B 2 HOH 7 1007 1007 HOH HOH A . B 2 HOH 8 1008 1008 HOH HOH A . B 2 HOH 9 1009 1009 HOH HOH A . B 2 HOH 10 1010 1010 HOH HOH A . B 2 HOH 11 1011 1011 HOH HOH A . B 2 HOH 12 1012 1012 HOH HOH A . B 2 HOH 13 1013 1013 HOH HOH A . B 2 HOH 14 1014 1014 HOH HOH A . B 2 HOH 15 1015 1015 HOH HOH A . B 2 HOH 16 1016 1016 HOH HOH A . B 2 HOH 17 1017 1017 HOH HOH A . B 2 HOH 18 1018 1018 HOH HOH A . B 2 HOH 19 1019 1019 HOH HOH A . B 2 HOH 20 1020 1020 HOH HOH A . B 2 HOH 21 1021 1021 HOH HOH A . B 2 HOH 22 1022 1022 HOH HOH A . B 2 HOH 23 1023 1023 HOH HOH A . B 2 HOH 24 1024 1024 HOH HOH A . B 2 HOH 25 1025 1025 HOH HOH A . B 2 HOH 26 1026 1026 HOH HOH A . B 2 HOH 27 1027 1027 HOH HOH A . B 2 HOH 28 1028 1028 HOH HOH A . B 2 HOH 29 1029 1029 HOH HOH A . B 2 HOH 30 1030 1030 HOH HOH A . B 2 HOH 31 1031 1031 HOH HOH A . B 2 HOH 32 1032 1032 HOH HOH A . B 2 HOH 33 1033 1033 HOH HOH A . B 2 HOH 34 1034 1034 HOH HOH A . B 2 HOH 35 1035 1035 HOH HOH A . B 2 HOH 36 1036 1036 HOH HOH A . B 2 HOH 37 1037 1037 HOH HOH A . B 2 HOH 38 1038 1038 HOH HOH A . B 2 HOH 39 1039 1039 HOH HOH A . B 2 HOH 40 1040 1040 HOH HOH A . B 2 HOH 41 1041 1041 HOH HOH A . B 2 HOH 42 1042 1042 HOH HOH A . B 2 HOH 43 1043 1043 HOH HOH A . B 2 HOH 44 1044 1044 HOH HOH A . B 2 HOH 45 1045 1045 HOH HOH A . B 2 HOH 46 1046 1046 HOH HOH A . B 2 HOH 47 1047 1047 HOH HOH A . B 2 HOH 48 1048 1048 HOH HOH A . B 2 HOH 49 1049 1049 HOH HOH A . B 2 HOH 50 1050 1050 HOH HOH A . B 2 HOH 51 1051 1051 HOH HOH A . B 2 HOH 52 1052 1052 HOH HOH A . B 2 HOH 53 1053 1053 HOH HOH A . B 2 HOH 54 1054 1054 HOH HOH A . B 2 HOH 55 1055 1055 HOH HOH A . B 2 HOH 56 1056 1056 HOH HOH A . B 2 HOH 57 1057 1057 HOH HOH A . B 2 HOH 58 1058 1058 HOH HOH A . B 2 HOH 59 1059 1059 HOH HOH A . B 2 HOH 60 1060 1060 HOH HOH A . B 2 HOH 61 1061 1061 HOH HOH A . B 2 HOH 62 1062 1062 HOH HOH A . B 2 HOH 63 1063 1063 HOH HOH A . B 2 HOH 64 1064 1064 HOH HOH A . B 2 HOH 65 1065 1065 HOH HOH A . B 2 HOH 66 1066 1066 HOH HOH A . B 2 HOH 67 1067 1067 HOH HOH A . B 2 HOH 68 1068 1068 HOH HOH A . B 2 HOH 69 1069 1069 HOH HOH A . B 2 HOH 70 1070 1070 HOH HOH A . B 2 HOH 71 1071 1071 HOH HOH A . B 2 HOH 72 1072 1072 HOH HOH A . B 2 HOH 73 1073 1073 HOH HOH A . B 2 HOH 74 1074 1074 HOH HOH A . B 2 HOH 75 1075 1075 HOH HOH A . B 2 HOH 76 1076 1076 HOH HOH A . B 2 HOH 77 1077 1077 HOH HOH A . B 2 HOH 78 1078 1078 HOH HOH A . B 2 HOH 79 1079 1079 HOH HOH A . B 2 HOH 80 1080 1080 HOH HOH A . B 2 HOH 81 1081 1081 HOH HOH A . B 2 HOH 82 1082 1082 HOH HOH A . B 2 HOH 83 1083 1083 HOH HOH A . B 2 HOH 84 1084 1084 HOH HOH A . B 2 HOH 85 1085 1085 HOH HOH A . B 2 HOH 86 1086 1086 HOH HOH A . B 2 HOH 87 1087 1087 HOH HOH A . B 2 HOH 88 1088 1088 HOH HOH A . B 2 HOH 89 1089 1089 HOH HOH A . B 2 HOH 90 1090 1090 HOH HOH A . B 2 HOH 91 1091 1091 HOH HOH A . B 2 HOH 92 1092 1092 HOH HOH A . B 2 HOH 93 1093 1093 HOH HOH A . B 2 HOH 94 1094 1094 HOH HOH A . B 2 HOH 95 1095 1095 HOH HOH A . B 2 HOH 96 1096 1096 HOH HOH A . B 2 HOH 97 1097 1097 HOH HOH A . B 2 HOH 98 1098 1098 HOH HOH A . B 2 HOH 99 1099 1099 HOH HOH A . B 2 HOH 100 1100 1100 HOH HOH A . B 2 HOH 101 1101 1101 HOH HOH A . B 2 HOH 102 1102 1102 HOH HOH A . B 2 HOH 103 1103 1103 HOH HOH A . B 2 HOH 104 1104 1104 HOH HOH A . B 2 HOH 105 1105 1105 HOH HOH A . B 2 HOH 106 1106 1106 HOH HOH A . B 2 HOH 107 1107 1107 HOH HOH A . B 2 HOH 108 1108 1108 HOH HOH A . B 2 HOH 109 1109 1109 HOH HOH A . B 2 HOH 110 1110 1110 HOH HOH A . B 2 HOH 111 1111 1111 HOH HOH A . B 2 HOH 112 1112 1112 HOH HOH A . B 2 HOH 113 1113 1113 HOH HOH A . B 2 HOH 114 1114 1114 HOH HOH A . B 2 HOH 115 1115 1115 HOH HOH A . B 2 HOH 116 1116 1116 HOH HOH A . B 2 HOH 117 1117 1117 HOH HOH A . B 2 HOH 118 1118 1118 HOH HOH A . B 2 HOH 119 1119 1119 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-05-22 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-18 5 'Structure model' 1 4 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' database_2 3 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.date' 5 4 'Structure model' '_software.language' 6 4 'Structure model' '_software.location' 7 4 'Structure model' '_software.name' 8 4 'Structure model' '_software.type' 9 4 'Structure model' '_software.version' 10 5 'Structure model' '_database_2.pdbx_DOI' 11 5 'Structure model' '_database_2.pdbx_database_accession' 12 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns.csb.yale.edu/v1.1/ Fortran_77 ? 3 PDB_EXTRACT 2.000 'April. 3, 2006' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 4 SBC-Collect 19ID ? ? ? ? 'data collection' ? ? ? 5 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 6 CNS . ? ? ? ? phasing ? ? ? 7 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 51 ? ? -111.93 -133.21 2 1 ALA A 52 ? ? 53.90 87.98 3 1 ARG A 97 ? ? -115.76 68.73 4 1 ALA A 108 ? ? -90.80 -126.07 5 1 THR A 110 ? ? -177.91 141.31 6 1 TYR A 112 ? ? 63.53 -28.31 7 1 SER A 114 ? ? -142.56 -38.38 8 1 GLU A 169 ? ? -146.22 32.16 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 1 ? A GLN 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A ARG 5 ? A ARG 5 6 1 Y 1 A PRO 6 ? A PRO 6 7 1 Y 1 A ARG 7 ? A ARG 7 8 1 Y 1 A ARG 8 ? A ARG 8 9 1 Y 1 A PRO 9 ? A PRO 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A PHE 42 ? A PHE 42 12 1 Y 1 A LEU 43 ? A LEU 43 13 1 Y 1 A GLN 44 ? A GLN 44 14 1 Y 1 A GLU 45 ? A GLU 45 15 1 Y 1 A GLN 46 ? A GLN 46 16 1 Y 1 A GLY 47 ? A GLY 47 17 1 Y 1 A HIS 48 ? A HIS 48 18 1 Y 1 A ARG 49 ? A ARG 49 19 1 Y 1 A ARG 181 ? A ARG 181 20 1 Y 1 A ARG 182 ? A ARG 182 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #