data_2P03 # _entry.id 2P03 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2P03 pdb_00002p03 10.2210/pdb2p03/pdb RCSB RCSB041799 ? ? WWPDB D_1000041799 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2P01 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2P03 _pdbx_database_status.recvd_initial_deposition_date 2007-02-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lee, D.' 1 'Walsh, J.D.' 2 'Migliorini, M.' 3 'Yu, P.' 4 'Cai, T.' 5 'Schwieters, C.D.' 6 'Krueger, S.' 7 'Strickland, D.K.' 8 'Wang, Y.X.' 9 # _citation.id primary _citation.title 'The structure of receptor-associated protein (RAP).' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 16 _citation.page_first 1628 _citation.page_last 1640 _citation.year 2007 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17656581 _citation.pdbx_database_id_DOI 10.1110/ps.072865407 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, D.' 1 ? primary 'Walsh, J.D.' 2 ? primary 'Migliorini, M.' 3 ? primary 'Yu, P.' 4 ? primary 'Cai, T.' 5 ? primary 'Schwieters, C.D.' 6 ? primary 'Krueger, S.' 7 ? primary 'Strickland, D.K.' 8 ? primary 'Wang, Y.X.' 9 ? # _cell.entry_id 2P03 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2P03 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Alpha-2-macroglobulin receptor-associated protein' _entity.formula_weight 37849.602 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Residues 35-357' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Alpha-2- MRAP, Low density lipoprotein receptor-related protein-associated protein 1, RAP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;YSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRN LNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLS RTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKEL EAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARH NEL ; _entity_poly.pdbx_seq_one_letter_code_can ;YSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRN LNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLS RTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKEL EAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARH NEL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 SER n 1 3 ARG n 1 4 GLU n 1 5 LYS n 1 6 ASN n 1 7 GLN n 1 8 PRO n 1 9 LYS n 1 10 PRO n 1 11 SER n 1 12 PRO n 1 13 LYS n 1 14 ARG n 1 15 GLU n 1 16 SER n 1 17 GLY n 1 18 GLU n 1 19 GLU n 1 20 PHE n 1 21 ARG n 1 22 MET n 1 23 GLU n 1 24 LYS n 1 25 LEU n 1 26 ASN n 1 27 GLN n 1 28 LEU n 1 29 TRP n 1 30 GLU n 1 31 LYS n 1 32 ALA n 1 33 GLN n 1 34 ARG n 1 35 LEU n 1 36 HIS n 1 37 LEU n 1 38 PRO n 1 39 PRO n 1 40 VAL n 1 41 ARG n 1 42 LEU n 1 43 ALA n 1 44 GLU n 1 45 LEU n 1 46 HIS n 1 47 ALA n 1 48 ASP n 1 49 LEU n 1 50 LYS n 1 51 ILE n 1 52 GLN n 1 53 GLU n 1 54 ARG n 1 55 ASP n 1 56 GLU n 1 57 LEU n 1 58 ALA n 1 59 TRP n 1 60 LYS n 1 61 LYS n 1 62 LEU n 1 63 LYS n 1 64 LEU n 1 65 ASP n 1 66 GLY n 1 67 LEU n 1 68 ASP n 1 69 GLU n 1 70 ASP n 1 71 GLY n 1 72 GLU n 1 73 LYS n 1 74 GLU n 1 75 ALA n 1 76 ARG n 1 77 LEU n 1 78 ILE n 1 79 ARG n 1 80 ASN n 1 81 LEU n 1 82 ASN n 1 83 VAL n 1 84 ILE n 1 85 LEU n 1 86 ALA n 1 87 LYS n 1 88 TYR n 1 89 GLY n 1 90 LEU n 1 91 ASP n 1 92 GLY n 1 93 LYS n 1 94 LYS n 1 95 ASP n 1 96 ALA n 1 97 ARG n 1 98 GLN n 1 99 VAL n 1 100 THR n 1 101 SER n 1 102 ASN n 1 103 SER n 1 104 LEU n 1 105 SER n 1 106 GLY n 1 107 THR n 1 108 GLN n 1 109 GLU n 1 110 ASP n 1 111 GLY n 1 112 LEU n 1 113 ASP n 1 114 ASP n 1 115 PRO n 1 116 ARG n 1 117 LEU n 1 118 GLU n 1 119 LYS n 1 120 LEU n 1 121 TRP n 1 122 HIS n 1 123 LYS n 1 124 ALA n 1 125 LYS n 1 126 THR n 1 127 SER n 1 128 GLY n 1 129 LYS n 1 130 PHE n 1 131 SER n 1 132 GLY n 1 133 GLU n 1 134 GLU n 1 135 LEU n 1 136 ASP n 1 137 LYS n 1 138 LEU n 1 139 TRP n 1 140 ARG n 1 141 GLU n 1 142 PHE n 1 143 LEU n 1 144 HIS n 1 145 HIS n 1 146 LYS n 1 147 GLU n 1 148 LYS n 1 149 VAL n 1 150 HIS n 1 151 GLU n 1 152 TYR n 1 153 ASN n 1 154 VAL n 1 155 LEU n 1 156 LEU n 1 157 GLU n 1 158 THR n 1 159 LEU n 1 160 SER n 1 161 ARG n 1 162 THR n 1 163 GLU n 1 164 GLU n 1 165 ILE n 1 166 HIS n 1 167 GLU n 1 168 ASN n 1 169 VAL n 1 170 ILE n 1 171 SER n 1 172 PRO n 1 173 SER n 1 174 ASP n 1 175 LEU n 1 176 SER n 1 177 ASP n 1 178 ILE n 1 179 LYS n 1 180 GLY n 1 181 SER n 1 182 VAL n 1 183 LEU n 1 184 HIS n 1 185 SER n 1 186 ARG n 1 187 HIS n 1 188 THR n 1 189 GLU n 1 190 LEU n 1 191 LYS n 1 192 GLU n 1 193 LYS n 1 194 LEU n 1 195 ARG n 1 196 SER n 1 197 ILE n 1 198 ASN n 1 199 GLN n 1 200 GLY n 1 201 LEU n 1 202 ASP n 1 203 ARG n 1 204 LEU n 1 205 ARG n 1 206 ARG n 1 207 VAL n 1 208 SER n 1 209 HIS n 1 210 GLN n 1 211 GLY n 1 212 TYR n 1 213 SER n 1 214 THR n 1 215 GLU n 1 216 ALA n 1 217 GLU n 1 218 PHE n 1 219 GLU n 1 220 GLU n 1 221 PRO n 1 222 ARG n 1 223 VAL n 1 224 ILE n 1 225 ASP n 1 226 LEU n 1 227 TRP n 1 228 ASP n 1 229 LEU n 1 230 ALA n 1 231 GLN n 1 232 SER n 1 233 ALA n 1 234 ASN n 1 235 LEU n 1 236 THR n 1 237 ASP n 1 238 LYS n 1 239 GLU n 1 240 LEU n 1 241 GLU n 1 242 ALA n 1 243 PHE n 1 244 ARG n 1 245 GLU n 1 246 GLU n 1 247 LEU n 1 248 LYS n 1 249 HIS n 1 250 PHE n 1 251 GLU n 1 252 ALA n 1 253 LYS n 1 254 ILE n 1 255 GLU n 1 256 LYS n 1 257 HIS n 1 258 ASN n 1 259 HIS n 1 260 TYR n 1 261 GLN n 1 262 LYS n 1 263 GLN n 1 264 LEU n 1 265 GLU n 1 266 ILE n 1 267 ALA n 1 268 HIS n 1 269 GLU n 1 270 LYS n 1 271 LEU n 1 272 ARG n 1 273 HIS n 1 274 ALA n 1 275 GLU n 1 276 SER n 1 277 VAL n 1 278 GLY n 1 279 ASP n 1 280 GLY n 1 281 GLU n 1 282 ARG n 1 283 VAL n 1 284 SER n 1 285 ARG n 1 286 SER n 1 287 ARG n 1 288 GLU n 1 289 LYS n 1 290 HIS n 1 291 ALA n 1 292 LEU n 1 293 LEU n 1 294 GLU n 1 295 GLY n 1 296 ARG n 1 297 THR n 1 298 LYS n 1 299 GLU n 1 300 LEU n 1 301 GLY n 1 302 TYR n 1 303 THR n 1 304 VAL n 1 305 LYS n 1 306 LYS n 1 307 HIS n 1 308 LEU n 1 309 GLN n 1 310 ASP n 1 311 LEU n 1 312 SER n 1 313 GLY n 1 314 ARG n 1 315 ILE n 1 316 SER n 1 317 ARG n 1 318 ALA n 1 319 ARG n 1 320 HIS n 1 321 ASN n 1 322 GLU n 1 323 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene LRPAP1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AMRP_HUMAN _struct_ref.pdbx_db_accession P30533 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;YSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRN LNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLS RTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKEL EAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARH NEL ; _struct_ref.pdbx_align_begin 35 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2P03 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 323 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P30533 _struct_ref_seq.db_align_beg 35 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 357 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 323 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 3D_13C-separated_NOESY 1 3 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.25 _pdbx_nmr_exptl_sample_conditions.ionic_strength '75 mM NaPi 50 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 600 ? 2 INOVA Varian 800 ? # _pdbx_nmr_refine.entry_id 2P03 _pdbx_nmr_refine.method 'RG refinement' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2P03 _pdbx_nmr_details.text 'RG based on SANS experiment' # _pdbx_nmr_ensemble.entry_id 2P03 _pdbx_nmr_ensemble.conformers_calculated_total_number 1 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'energy minimized average structure' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2P03 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' CYANA 2.1.4 'P.GUNTERT ET AL.' 1 refinement X-PLOR 3 ? 2 # _exptl.entry_id 2P03 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2P03 _struct.title 'The structure of receptor-associated protein(RAP)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2P03 _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'receptor-associated protein, RAP, CELL ADHESION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 22 ? HIS A 36 ? MET A 22 HIS A 36 1 ? 15 HELX_P HELX_P2 2 PRO A 38 ? GLY A 66 ? PRO A 38 GLY A 66 1 ? 29 HELX_P HELX_P3 3 GLY A 71 ? GLY A 89 ? GLY A 71 GLY A 89 1 ? 19 HELX_P HELX_P4 4 ASP A 114 ? GLY A 128 ? ASP A 114 GLY A 128 1 ? 15 HELX_P HELX_P5 5 GLY A 132 ? THR A 162 ? GLY A 132 THR A 162 1 ? 31 HELX_P HELX_P6 6 LEU A 183 ? GLN A 210 ? LEU A 183 GLN A 210 1 ? 28 HELX_P HELX_P7 7 ARG A 222 ? GLN A 231 ? ARG A 222 GLN A 231 1 ? 10 HELX_P HELX_P8 8 THR A 236 ? GLU A 275 ? THR A 236 GLU A 275 1 ? 40 HELX_P HELX_P9 9 SER A 276 ? GLY A 278 ? SER A 276 GLY A 278 5 ? 3 HELX_P HELX_P10 10 ARG A 282 ? SER A 316 ? ARG A 282 SER A 316 1 ? 35 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2P03 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2P03 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 1 1 TYR TYR A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 TRP 121 121 121 TRP TRP A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 TRP 139 139 139 TRP TRP A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 HIS 144 144 144 HIS HIS A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 HIS 166 166 166 HIS HIS A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 HIS 184 184 184 HIS HIS A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 GLN 199 199 199 GLN GLN A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 ASP 202 202 202 ASP ASP A . n A 1 203 ARG 203 203 203 ARG ARG A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 ARG 205 205 205 ARG ARG A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 HIS 209 209 209 HIS HIS A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 THR 214 214 214 THR THR A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 PHE 218 218 218 PHE PHE A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 GLU 220 220 220 GLU GLU A . n A 1 221 PRO 221 221 221 PRO PRO A . n A 1 222 ARG 222 222 222 ARG ARG A . n A 1 223 VAL 223 223 223 VAL VAL A . n A 1 224 ILE 224 224 224 ILE ILE A . n A 1 225 ASP 225 225 225 ASP ASP A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 TRP 227 227 227 TRP TRP A . n A 1 228 ASP 228 228 228 ASP ASP A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 ALA 230 230 230 ALA ALA A . n A 1 231 GLN 231 231 231 GLN GLN A . n A 1 232 SER 232 232 232 SER SER A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 ASN 234 234 234 ASN ASN A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 ASP 237 237 237 ASP ASP A . n A 1 238 LYS 238 238 238 LYS LYS A . n A 1 239 GLU 239 239 239 GLU GLU A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 GLU 241 241 241 GLU GLU A . n A 1 242 ALA 242 242 242 ALA ALA A . n A 1 243 PHE 243 243 243 PHE PHE A . n A 1 244 ARG 244 244 244 ARG ARG A . n A 1 245 GLU 245 245 245 GLU GLU A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 HIS 249 249 249 HIS HIS A . n A 1 250 PHE 250 250 250 PHE PHE A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 ILE 254 254 254 ILE ILE A . n A 1 255 GLU 255 255 255 GLU GLU A . n A 1 256 LYS 256 256 256 LYS LYS A . n A 1 257 HIS 257 257 257 HIS HIS A . n A 1 258 ASN 258 258 258 ASN ASN A . n A 1 259 HIS 259 259 259 HIS HIS A . n A 1 260 TYR 260 260 260 TYR TYR A . n A 1 261 GLN 261 261 261 GLN GLN A . n A 1 262 LYS 262 262 262 LYS LYS A . n A 1 263 GLN 263 263 263 GLN GLN A . n A 1 264 LEU 264 264 264 LEU LEU A . n A 1 265 GLU 265 265 265 GLU GLU A . n A 1 266 ILE 266 266 266 ILE ILE A . n A 1 267 ALA 267 267 267 ALA ALA A . n A 1 268 HIS 268 268 268 HIS HIS A . n A 1 269 GLU 269 269 269 GLU GLU A . n A 1 270 LYS 270 270 270 LYS LYS A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 ARG 272 272 272 ARG ARG A . n A 1 273 HIS 273 273 273 HIS HIS A . n A 1 274 ALA 274 274 274 ALA ALA A . n A 1 275 GLU 275 275 275 GLU GLU A . n A 1 276 SER 276 276 276 SER SER A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 GLY 278 278 278 GLY GLY A . n A 1 279 ASP 279 279 279 ASP ASP A . n A 1 280 GLY 280 280 280 GLY GLY A . n A 1 281 GLU 281 281 281 GLU GLU A . n A 1 282 ARG 282 282 282 ARG ARG A . n A 1 283 VAL 283 283 283 VAL VAL A . n A 1 284 SER 284 284 284 SER SER A . n A 1 285 ARG 285 285 285 ARG ARG A . n A 1 286 SER 286 286 286 SER SER A . n A 1 287 ARG 287 287 287 ARG ARG A . n A 1 288 GLU 288 288 288 GLU GLU A . n A 1 289 LYS 289 289 289 LYS LYS A . n A 1 290 HIS 290 290 290 HIS HIS A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 LEU 292 292 292 LEU LEU A . n A 1 293 LEU 293 293 293 LEU LEU A . n A 1 294 GLU 294 294 294 GLU GLU A . n A 1 295 GLY 295 295 295 GLY GLY A . n A 1 296 ARG 296 296 296 ARG ARG A . n A 1 297 THR 297 297 297 THR THR A . n A 1 298 LYS 298 298 298 LYS LYS A . n A 1 299 GLU 299 299 299 GLU GLU A . n A 1 300 LEU 300 300 300 LEU LEU A . n A 1 301 GLY 301 301 301 GLY GLY A . n A 1 302 TYR 302 302 302 TYR TYR A . n A 1 303 THR 303 303 303 THR THR A . n A 1 304 VAL 304 304 304 VAL VAL A . n A 1 305 LYS 305 305 305 LYS LYS A . n A 1 306 LYS 306 306 306 LYS LYS A . n A 1 307 HIS 307 307 307 HIS HIS A . n A 1 308 LEU 308 308 308 LEU LEU A . n A 1 309 GLN 309 309 309 GLN GLN A . n A 1 310 ASP 310 310 310 ASP ASP A . n A 1 311 LEU 311 311 311 LEU LEU A . n A 1 312 SER 312 312 312 SER SER A . n A 1 313 GLY 313 313 313 GLY GLY A . n A 1 314 ARG 314 314 314 ARG ARG A . n A 1 315 ILE 315 315 315 ILE ILE A . n A 1 316 SER 316 316 316 SER SER A . n A 1 317 ARG 317 317 317 ARG ARG A . n A 1 318 ALA 318 318 318 ALA ALA A . n A 1 319 ARG 319 319 319 ARG ARG A . n A 1 320 HIS 320 320 320 HIS HIS A . n A 1 321 ASN 321 321 321 ASN ASN A . n A 1 322 GLU 322 322 322 GLU GLU A . n A 1 323 LEU 323 323 323 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A GLU 281 ? ? HH21 A ARG 282 ? ? 1.20 2 1 HE A ARG 76 ? ? HD22 A ASN 80 ? ? 1.20 3 1 O A LYS 129 ? ? H A SER 131 ? ? 1.31 4 1 O A ARG 161 ? ? H A GLU 163 ? ? 1.33 5 1 O A LEU 229 ? ? H A SER 232 ? ? 1.42 6 1 O A HIS 320 ? ? H A GLU 322 ? ? 1.54 7 1 O A SER 232 ? ? H A ASN 234 ? ? 1.56 8 1 O A THR 236 ? ? H A LEU 240 ? ? 1.56 9 1 O A GLN 199 ? ? OD2 A ASP 202 ? ? 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 3 ? ? -155.87 73.89 2 1 GLU A 4 ? ? -74.64 29.14 3 1 LYS A 5 ? ? -47.04 93.39 4 1 ASN A 6 ? ? -64.34 92.06 5 1 SER A 11 ? ? -161.58 60.25 6 1 PHE A 20 ? ? -129.22 -167.79 7 1 HIS A 36 ? ? 65.03 117.02 8 1 PRO A 38 ? ? -43.21 158.41 9 1 ASP A 68 ? ? -67.85 95.14 10 1 GLU A 69 ? ? -96.07 -77.18 11 1 ASP A 70 ? ? -44.98 -8.63 12 1 ASP A 91 ? ? -75.46 -84.90 13 1 THR A 100 ? ? -141.21 -18.28 14 1 SER A 101 ? ? 47.67 171.95 15 1 SER A 103 ? ? -166.95 89.74 16 1 LEU A 104 ? ? -174.24 116.70 17 1 SER A 105 ? ? -145.26 -77.90 18 1 THR A 107 ? ? 48.39 169.53 19 1 GLN A 108 ? ? -175.65 86.70 20 1 ASP A 110 ? ? -60.07 -80.84 21 1 LEU A 112 ? ? -106.07 65.81 22 1 ASP A 113 ? ? -107.33 -77.52 23 1 LYS A 129 ? ? -178.58 20.62 24 1 PHE A 130 ? ? -59.62 50.05 25 1 THR A 162 ? ? -61.26 48.16 26 1 GLU A 163 ? ? -150.88 -32.26 27 1 HIS A 166 ? ? 179.97 24.85 28 1 ASN A 168 ? ? -145.21 -85.05 29 1 SER A 173 ? ? 174.91 110.65 30 1 LEU A 175 ? ? -150.69 52.79 31 1 SER A 176 ? ? 47.47 108.51 32 1 ASP A 177 ? ? -47.98 79.60 33 1 SER A 181 ? ? -176.04 -48.88 34 1 LEU A 183 ? ? 65.12 -21.11 35 1 GLN A 210 ? ? -136.14 -33.81 36 1 THR A 214 ? ? -161.57 -62.76 37 1 ALA A 216 ? ? 175.38 110.74 38 1 GLU A 217 ? ? -160.12 34.35 39 1 PHE A 218 ? ? -122.04 -62.02 40 1 GLU A 219 ? ? -69.99 -125.58 41 1 ARG A 222 ? ? -140.22 -26.30 42 1 VAL A 223 ? ? -64.97 -86.97 43 1 ALA A 230 ? ? -32.64 -34.28 44 1 ALA A 233 ? ? -68.60 52.11 45 1 ASN A 234 ? ? 31.95 85.87 46 1 LEU A 235 ? ? -116.46 -164.20 47 1 ASP A 237 ? ? -33.70 -72.05 48 1 LYS A 238 ? ? -42.11 -74.73 49 1 LEU A 240 ? ? -63.83 -78.49 50 1 GLU A 241 ? ? -26.64 -46.26 51 1 PHE A 250 ? ? -66.74 -72.02 52 1 ASP A 279 ? ? -174.51 -50.40 53 1 GLU A 281 ? ? -147.62 -61.16 54 1 SER A 284 ? ? -56.75 -76.75 55 1 GLU A 288 ? ? -61.72 -70.67 56 1 ASP A 310 ? ? -69.18 -71.66 57 1 ARG A 314 ? ? -96.39 -69.65 58 1 ILE A 315 ? ? -26.29 -68.76 59 1 SER A 316 ? ? -28.46 148.68 60 1 ARG A 317 ? ? 61.64 -70.27 61 1 ALA A 318 ? ? 68.90 73.82 62 1 ARG A 319 ? ? -59.28 -163.57 63 1 ASN A 321 ? ? -67.96 44.49 64 1 GLU A 322 ? ? 58.87 -76.13 #